refactor(topics): 멀티 에이전트용 지식 재편 — _Common(공통 기본기) + Domain_* 구조

에이전트 8종(대화형/프로그래머 C·S/디자이너/설계자/기획자/QA/PD/PM)에게
[공통 기본 능력 + 롤별 Specialty] 2층으로 지식을 주입하기 위한 재분류.
문서 내용·포맷은 무수정, 폴더 이동만 (6,372개 문서 수 보존 확인).

- Topic_Programming → Domain_Programming (내부 구조 보존)
- Topic_Graphic → Domain_Design
- Topic_Business → Domain_Product
- Topic_General → Domain_General
- _Common 신설: Math(구 Topic_Math_Specialty), Reasoning(구 General/From_Thinking & Reasoning),
  Reasoning_Creativity(구 General/From_창의성), Communication(Poetic_Blog_Writing + From_writing)
- 타 도메인의 From_* 폴더는 유지 (출처 표기일 뿐, 이미 도메인에 맞게 분류된 문서)
- 빈 폴더 정리 (memory/procedures)
- 에이전트→폴더 매핑은 workspace의 .astra/agent-knowledge-map.json (9개 에이전트)

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
This commit is contained in:
Antigravity Agent
2026-07-11 11:05:56 +09:00
co-authored by Claude Fable 5
parent 6549ead309
commit c24165b8bc
6193 changed files with 1717 additions and 31 deletions
@@ -0,0 +1,146 @@
---
id: wiki-2026-0508-acl-prevention
title: ACL Prevention
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-HEALTH-001, ACL Injury Prevention]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, devops, health, biomechanics]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: pandas
---
# ACL Prevention
## 매 한 줄
> **"매 ACL 부상 prevention 의 핵심 = neuromuscular training + landing mechanics + proprioception."**. ACL (Anterior Cruciate Ligament) tear 의 70% 는 non-contact pivoting/landing 상황에서 발생하며, FIFA 11+, PEP, KIPP 같은 evidence-based program 이 incidence 를 50-70% 감소시킨다.
## 매 핵심
### 매 Risk Factor
- **Modifiable**: knee valgus on landing, weak hip abductors, quad-dominant deceleration, fatigue.
- **Non-modifiable**: female sex (2-8x risk), narrow intercondylar notch, generalized joint laxity.
- **Environmental**: cleat-surface interaction, fatigue late in match, prior injury history.
### 매 Prevention Pillar
- **Neuromuscular training** — plyometric + balance + strength, 2-3x/week.
- **Landing mechanics** — soft landing, knee over toe, hip-dominant.
- **Core/hip strength** — gluteus medius, hip external rotators.
- **Proprioception** — single-leg balance, perturbation training.
### 매 응용
1. Youth soccer FIFA 11+ warmup (15 min pre-training).
2. Female collegiate athletes PEP program.
3. Post-ACLR return-to-sport batteries.
## 💻 패턴
### Risk Score Aggregator
```python
import pandas as pd
def acl_risk_score(athlete: dict) -> float:
"""0-1 risk; >0.6 → enroll in prevention program."""
score = 0.0
if athlete["sex"] == "F": score += 0.25
if athlete["prior_acl"]: score += 0.30
if athlete["knee_valgus_deg"] > 8: score += 0.20
if athlete["hop_lsi"] < 0.85: score += 0.15 # limb symmetry
if athlete["age"] < 18: score += 0.10
return min(score, 1.0)
```
### Drop Vertical Jump (DVJ) Analyzer
```python
import numpy as np
def knee_abduction_moment(forces, lever_arms):
"""Hewett 2005 — KAM > 25.3 Nm predicts ACL injury."""
return np.dot(forces, lever_arms)
def classify_landing(kam_nm: float) -> str:
if kam_nm > 25.3: return "high-risk"
if kam_nm > 15.0: return "moderate"
return "low-risk"
```
### FIFA 11+ Session Builder
```python
FIFA_11_PLUS = {
"part1_running": ["straight ahead", "hip out", "hip in", "circling partner"],
"part2_strength": ["bench", "sideways bench", "hamstrings", "single-leg stance"],
"part3_running": ["across pitch", "bounding", "plant-and-cut"],
}
def build_session(level: int = 1) -> list[str]:
drills = []
for part, items in FIFA_11_PLUS.items():
drills.extend(items if level >= 2 else items[:2])
return drills
```
### Hop Test Battery
```python
def hop_lsi(injured: float, uninjured: float) -> float:
"""Limb Symmetry Index — RTS threshold ≥ 0.90."""
return injured / uninjured
def cleared_for_rts(single_hop, triple_hop, crossover) -> bool:
return all(lsi >= 0.90 for lsi in (single_hop, triple_hop, crossover))
```
### Cohort Tracking with Pandas
```python
import pandas as pd
def season_incidence(df: pd.DataFrame) -> pd.Series:
"""ACL injuries per 1000 athlete-exposures."""
return df.groupby("team")["acl_injury"].sum() / df.groupby("team")["ae"].sum() * 1000
```
### Fatigue Monitor
```python
def fatigue_flag(rpe: int, srpe_load: int, acwr: float) -> bool:
"""Acute:chronic workload ratio > 1.5 → injury risk spike."""
return rpe >= 8 or acwr > 1.5
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Youth team, no history | FIFA 11+ |
| Female collegiate | PEP / KIPP |
| Post-ACLR | Criterion-based RTS battery |
| Pro athlete in-season | Modified neuromuscular maintenance |
**기본값**: FIFA 11+ 2-3x/week.
## 🔗 Graph
## 🤖 LLM 활용
**언제**: structured risk-stratification, program selection, periodization advice.
**언제 X**: clinical diagnosis, surgical decision, individualized rehab prescription.
## ❌ 안티패턴
- **Static stretching only**: 매 효과 없음. Dynamic warmup 필요.
- **Knee-only focus**: hip/core ignore 시 valgus 재발.
- **Volume without quality**: poor landing form 의 reps 는 risk 증가.
- **Generic program**: sex/age/sport-specific tailoring 없으면 effect size 감소.
## 🧪 검증 / 중복
- Verified (Hewett 2005, Sadoghi 2012 meta-analysis, FIFA 11+ RCT).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — full content with risk scoring + FIFA 11+ patterns |
@@ -0,0 +1,149 @@
---
id: wiki-2026-0508-adversarial-code-stylometry
title: Adversarial Code Stylometry
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-36585B, Code Authorship Obfuscation]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, ml, privacy, deanonymization]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: scikit-learn
---
# Adversarial Code Stylometry
## 매 한 줄
> **"매 source code 의 author 를 statistical fingerprint 로 식별 — 그리고 attacker 는 이를 회피한다."**. Code stylometry 는 AST features + n-grams + lexical patterns 로 author 를 95% accuracy 로 deanonymize 가능; adversarial stylometry 는 transformation/obfuscation 으로 이를 무력화한다.
## 매 핵심
### 매 Feature Family
- **Lexical**: identifier length, naming convention, comment density.
- **Syntactic (AST)**: subtree frequency, depth distribution, control-flow patterns.
- **Layout**: indentation, brace style, line length.
- **Semantic**: API choice, idiom preference (list comp vs loop).
### 매 Attack Surface
- **Open-source contributors** — GitHub commits 의 deanonymization.
- **Malware authorship** — APT attribution.
- **Plagiarism detection** — academic/hiring context.
- **Bug bounty / leak** — anonymous reporter identification.
### 매 Defense
1. Code transformation (Caliskan 2018 — paraphrase preserving semantics).
2. LLM-mediated rewrite (rewrite via Claude/GPT to neutralize style).
3. Style transfer to another author (mimicry).
4. Mechanical normalization (autoformatter + identifier randomization).
## 💻 패턴
### AST Feature Extractor
```python
import ast
from collections import Counter
def ast_node_freq(source: str) -> Counter:
tree = ast.parse(source)
return Counter(type(n).__name__ for n in ast.walk(tree))
```
### Author Classifier (sklearn)
```python
from sklearn.ensemble import RandomForestClassifier
from sklearn.feature_extraction.text import TfidfVectorizer
from sklearn.pipeline import Pipeline
pipe = Pipeline([
("tfidf", TfidfVectorizer(analyzer="char_wb", ngram_range=(2, 5))),
("rf", RandomForestClassifier(n_estimators=300, n_jobs=-1)),
])
pipe.fit(train_sources, train_authors)
```
### Style Obfuscation via Rewrite
```python
import anthropic
client = anthropic.Anthropic()
def neutralize_style(code: str) -> str:
msg = client.messages.create(
model="claude-opus-4-7",
max_tokens=4096,
messages=[{"role": "user", "content": f"""Rewrite this code to neutralize authorial style.
Preserve semantics exactly. Use generic identifiers, standard idioms, mechanical formatting.
```python
{code}
```"""}],
)
return msg.content[0].text
```
### Mimicry Attack (target style)
```python
def mimic(code: str, target_samples: list[str]) -> str:
"""Rewrite `code` to look like `target_samples` author."""
target_blob = "\n---\n".join(target_samples[:3])
prompt = f"Target author samples:\n{target_blob}\n\nRewrite preserving semantics:\n{code}"
return llm_call(prompt)
```
### Detection of Obfuscated Code
```python
def obfuscation_signal(code: str) -> float:
"""High score → likely autoformatted/normalized."""
feats = ast_node_freq(code)
entropy = -sum((c/sum(feats.values())) * np.log2(c/sum(feats.values())) for c in feats.values())
return 1.0 - entropy / np.log2(len(feats)) # uniform → 0, peaked → 1
```
### Defensive Pre-commit Hook
```bash
#!/usr/bin/env bash
# .git/hooks/pre-commit
ruff format --quiet .
python -m style_neutralizer **/*.py
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Anonymous OSS contribution | LLM rewrite + autoformat |
| Whistleblower | Full mimicry to public author |
| Defensive (detection) | Char n-gram + AST RF |
| Research baseline | Caliskan 2015 features |
**기본값**: autoformat + LLM neutralization for adversarial; char n-gram TF-IDF + RF for detection.
## 🔗 Graph
- 변형: [[Code Obfuscation]]
- Adjacent: [[Differential Privacy]]
## 🤖 LLM 활용
**언제**: style neutralization, mimicry attack, defensive paraphrase.
**언제 X**: ground-truth authorship verification 에 LLM judgment 단독 사용.
## ❌ 안티패턴
- **Autoformatter 만 의존**: AST/lexical features 는 그대로 leak.
- **Identifier rename only**: control-flow signature 가 식별 가능.
- **Single-pass LLM rewrite**: subtle idioms 잔존 — multi-pass 필요.
- **Train/test 동일 repo**: leakage — author-disjoint split 필수.
## 🧪 검증 / 중복
- Verified (Caliskan 2015 USENIX Sec, Abuhamad 2018 CCS).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — AST features, attack/defense patterns |
@@ -0,0 +1,137 @@
---
id: wiki-2026-0508-alternative-realities
title: Alternative Realities
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [XR, Mixed Reality, MR/AR/VR Spectrum]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [xr, vr, ar, mr, immersive]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: TypeScript
framework: WebXR/Three.js/Unity
---
# Alternative Realities
## 매 한 줄
> **"매 reality 는 spectrum 위 한 점이다."**. Milgram 1994 RV continuum 부터 modern XR (Apple Vision Pro M5, Quest 4, Snap Spectacles 6) 까지, alternative realities 는 physical reality 를 augment / replace / blend 하는 매 mediated environment 의 총칭. 2026 의 mainstream 은 passthrough MR + hand tracking + neural input.
## 매 핵심
### 매 Reality-Virtuality Continuum
- **VR (Virtual Reality)**: 매 100% synthetic — Quest 4, Vision Pro fully-immersive mode.
- **AR (Augmented Reality)**: 매 real + overlay — phone AR, Snap Spectacles, HoloLens.
- **MR (Mixed Reality)**: 매 real + virtual interact — Vision Pro passthrough, Quest 4 color passthrough.
- **XR (Extended Reality)**: 매 umbrella term — VR/AR/MR all-inclusive.
### 매 Tech Stack 2026
- **Display**: micro-OLED 4K/eye, varifocal, foveated rendering.
- **Tracking**: inside-out 6DoF, eye tracking, hand tracking 26-joint, body pose.
- **Input**: pinch + gaze (Vision Pro), neural EMG (Meta wristband 2026), voice (Whisper-on-device).
- **Compute**: Apple M5/Snapdragon XR3 — 매 on-device transformer inference.
### 매 응용
1. **Productivity**: Vision Pro virtual displays, Immersed VR coding.
2. **Training**: surgical sim, military, industrial maintenance.
3. **Therapy**: VR exposure (PTSD, phobia), pain distraction.
4. **Social**: Horizon Worlds, VRChat, Rec Room.
5. **Industrial Twin**: AR overlay on factory equipment.
## 💻 패턴
### WebXR session bootstrap
```typescript
// Modern WebXR (2026) — immersive-ar with hand tracking
const xr = navigator.xr;
if (await xr.isSessionSupported('immersive-ar')) {
const session = await xr.requestSession('immersive-ar', {
requiredFeatures: ['hand-tracking', 'hit-test'],
optionalFeatures: ['anchors', 'plane-detection', 'mesh-detection'],
});
session.addEventListener('end', cleanup);
await renderer.xr.setSession(session);
}
```
### Hand-tracking pinch gesture
```typescript
function onXRFrame(time: number, frame: XRFrame) {
const refSpace = renderer.xr.getReferenceSpace();
for (const inputSource of frame.session.inputSources) {
if (!inputSource.hand) continue;
const thumb = frame.getJointPose(inputSource.hand.get('thumb-tip'), refSpace);
const index = frame.getJointPose(inputSource.hand.get('index-finger-tip'), refSpace);
const dist = vec3.distance(thumb.transform.position, index.transform.position);
if (dist < 0.02) emit('pinch', inputSource.handedness);
}
}
```
### Passthrough + virtual content (Three.js)
```typescript
renderer.xr.enabled = true;
renderer.setClearAlpha(0); // 매 transparent — passthrough shows through
scene.background = null;
// 매 virtual cube anchored to detected plane
const anchor = await frame.createAnchor(planePose.transform, refSpace);
scene.add(makeCubeAtAnchor(anchor));
```
### Foveated rendering hint
```typescript
const layer = xr.glLayer;
layer.fixedFoveation = 0.7; // 매 0=off, 1=max — 매 30% GPU savings
```
### Eye-tracked gaze input
```typescript
session.requestReferenceSpace('viewer').then(viewerSpace => {
// 매 Vision Pro / Quest Pro — gaze ray from eye
const gazePose = frame.getPose(viewerSpace, refSpace);
raycaster.set(gazePose.transform.position, gazeDirection);
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Web 배포 | WebXR + Three.js |
| Native iOS | RealityKit + ARKit |
| Native Android | ARCore + Sceneform/Filament |
| Cross-platform native | Unity XR / Unreal |
| Enterprise 산업 | Vision Pro / HoloLens 2 |
**기본값**: 매 WebXR 시도 → 부족시 native.
## 🔗 Graph
- 부모: [[VR 엑서게임 (VR Exergaming)]] · [[HMD(Head-Mounted Display) 기반 엑서게임 환경]]
- 변형: [[Digital Twins]] · [[Digital Twins|Digital-Twin-Technology]]
- 응용: [[Beat Saber 엑서게임 연구(Beat Saber Exergaming Study)]] · [[Remote-Rehabilitation]]
- Adjacent: [[Visual-Effects-VFX]]
## 🤖 LLM 활용
**언제**: XR scene authoring, gesture pattern matching, accessibility caption generation.
**언제 X**: 매 real-time inner loop (latency budget 11ms) 에서 cloud LLM 호출.
## ❌ 안티패턴
- **VR 멀미 무시**: 매 locomotion = teleport/snap-turn 권장. Smooth locomotion 은 매 opt-in.
- **60fps 미만**: 매 90fps 미만 = motion sickness. 매 budget 11ms.
- **Untracked controllers**: 매 always handle controller-lost 이벤트.
- **Single-eye render**: 매 stereo render 필수 — single-eye 는 depth 깨짐.
## 🧪 검증 / 중복
- Verified: Milgram & Kishino 1994; W3C WebXR Device API 2024; Apple visionOS 3 docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — XR continuum + 2026 stack + WebXR patterns |
@@ -0,0 +1,149 @@
---
id: wiki-2026-0508-analyze-runtime-performance
title: Analyze runtime performance
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Performance Analysis, Profiling, Runtime Profiling]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [profiling, performance, devtools]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: JavaScript/Python
framework: Chrome DevTools/perf/py-spy
---
# Analyze runtime performance
## 매 한 줄
> **"매 측정 없이 최적화 없다."**. Runtime performance 분석은 sampling profiler + tracing + flame graph + RAIL/Web Vitals metrics 의 stack 으로 매 hot path 와 long task 를 식별. 2026 stack: Chrome Performance panel (Insights AI), perf+FlameGraph, py-spy, eBPF/bpftrace, Datadog APM.
## 매 핵심
### 매 Profiler Type
- **Sampling**: 매 N ms 마다 stack 캡처 — 매 low overhead, statistical (perf, py-spy, async-profiler).
- **Instrumentation**: 매 fn enter/exit 기록 — 매 accurate, high overhead.
- **Tracing**: 매 event timeline (Chrome trace, perfetto).
- **Hardware counters**: PMU — IPC, cache miss, branch miss.
### 매 RAIL Model (web)
- **Response**: < 100ms input → feedback.
- **Animation**: < 16ms / frame (60fps).
- **Idle**: 50ms work blocks max.
- **Load**: < 5s on 4G.
### 매 Core Web Vitals 2026
- **LCP** (Largest Contentful Paint) < 2.5s.
- **INP** (Interaction to Next Paint) < 200ms — 매 FID 대체 (2024+).
- **CLS** (Cumulative Layout Shift) < 0.1.
### 매 응용
1. Web app TTI/INP 개선.
2. Backend p99 latency 추적.
3. Game/XR frame budget.
4. ML inference latency.
5. CI pipeline 시간 단축.
## 💻 패턴
### Chrome Performance panel + AI insights
```javascript
// 매 manual marker — show up in Performance timeline
performance.mark('ai-search:start');
const r = await search(q);
performance.mark('ai-search:end');
performance.measure('ai-search', 'ai-search:start', 'ai-search:end');
// 매 record trace in DevTools → AI Insights highlights bottleneck (2025+)
```
### User Timing API + reporter
```javascript
const obs = new PerformanceObserver(list => {
list.getEntries().forEach(e => analytics('perf', { name: e.name, dur: e.duration }));
});
obs.observe({ entryTypes: ['measure', 'navigation', 'resource', 'longtask'] });
```
### py-spy live flame graph
```bash
# 매 attach to running PID, no code change
py-spy record -o flame.svg --pid 12345 --duration 30
# 매 live top-like
py-spy top --pid 12345
```
### Linux perf flame graph
```bash
sudo perf record -F 99 -g -p $PID -- sleep 30
sudo perf script | \
./stackcollapse-perf.pl | ./flamegraph.pl > flame.svg
```
### Web Vitals INP measurement
```javascript
import { onINP, onLCP, onCLS } from 'web-vitals';
onINP(m => beacon('inp', m.value, m.id));
onLCP(m => beacon('lcp', m.value, m.id));
onCLS(m => beacon('cls', m.value, m.id));
```
### Node --prof + --prof-process
```bash
node --prof server.js
# 매 after run
node --prof-process isolate-*.log > profile.txt
```
### eBPF (bpftrace) syscall latency
```bash
sudo bpftrace -e '
tracepoint:syscalls:sys_enter_read { @s[tid] = nsecs; }
tracepoint:syscalls:sys_exit_read /@s[tid]/ {
@us = hist((nsecs - @s[tid]) / 1000);
delete(@s[tid]);
}'
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| Web (Chromium) | DevTools Performance + Web Vitals |
| Node.js | clinic.js / 0x / --prof |
| Python | py-spy / scalene / cProfile |
| JVM | async-profiler / JFR |
| Go | pprof |
| Linux native | perf + FlameGraph / eBPF |
| Production APM | Datadog / NewRelic / OTel |
**기본값**: 매 sampling profiler 우선, instrumentation 은 spot-check.
## 🔗 Graph
- 부모: [[Flame_Graphs]]
- 변형: [[CPU Bottleneck]]
- 응용: [[High Resolution Time]] · [[Memory Management]]
- Adjacent: [[Page Experience Algorithm]] · [[Debugger_Techniques]]
## 🤖 LLM 활용
**언제**: flame graph 해석, perf insight 요약, regression hypothesis.
**언제 X**: 매 nanosecond-level profiling — specialized tool 만이 정확.
## ❌ 안티패턴
- **Production 에 instrumenting profiler**: 매 overhead 폭발.
- **Single-run 결론**: 매 statistical noise — multi-run 필요.
- **Average only**: 매 p50 보다 p99 가 user 체감.
- **Profile dev build**: 매 prod build 와 다름 — release/optimized 측정.
## 🧪 검증 / 중복
- Verified: web.dev Performance docs; Brendan Gregg "Systems Performance"; Chrome DevTools docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — RAIL/INP + multi-language profilers |
@@ -0,0 +1,148 @@
---
id: wiki-2026-0508-anomaly-detection
title: Anomaly Detection
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Outlier Detection, Novelty Detection, 이상 탐지]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, ml, monitoring, observability]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Python
framework: scikit-learn/PyOD/Prometheus
---
# Anomaly Detection
## 매 한 줄
> **"매 normal 의 boundary 를 학습하고 그 밖을 flag 한다."**. Anomaly detection 은 fraud, intrusion, equipment failure, log spike 등을 unsupervised 로 발견하는 매 core observability/security primitive. 2026 의 standard 는 Isolation Forest + LSTM-AE + transformer-based time-series (PatchTST, TimesNet).
## 매 핵심
### 매 Anomaly Type 3가지
- **Point anomaly**: 매 single observation 이 outlier — credit card 단일 거래.
- **Contextual anomaly**: 매 context 에서만 anomaly — 여름의 영하 온도.
- **Collective anomaly**: 매 group 으로만 anomaly — DDoS 의 packet sequence.
### 매 Algorithm Family
- **Statistical**: z-score, MAD, Grubbs, EWMA — 매 univariate baseline.
- **Distance-based**: kNN, LOF — 매 density 차이로 detect.
- **Tree-based**: Isolation Forest, Extended IF — 매 high-dim 잘 작동.
- **Reconstruction**: Autoencoder, VAE — 매 reconstruction error = anomaly score.
- **Time-series DL**: LSTM-AE, Transformer (PatchTST 2024, TimesNet) — 매 SOTA 2026.
- **One-class**: One-Class SVM, Deep SVDD — 매 normal-only training.
### 매 응용
1. **Fraud detection**: payment, account takeover.
2. **Intrusion detection (IDS)**: network traffic anomaly.
3. **Predictive maintenance**: vibration sensor, temp.
4. **APM**: latency/error rate spike — Datadog Watchdog, New Relic.
5. **Log anomaly**: unseen log template — DeepLog, LogBERT.
## 💻 패턴
### Isolation Forest baseline
```python
from sklearn.ensemble import IsolationForest
import numpy as np
# 매 contamination = expected anomaly fraction
clf = IsolationForest(contamination=0.01, n_estimators=200, random_state=42)
clf.fit(X_train)
scores = -clf.score_samples(X_test) # 매 high score = more anomalous
preds = clf.predict(X_test) # -1=anomaly, 1=normal
```
### LOF for density anomaly
```python
from sklearn.neighbors import LocalOutlierFactor
lof = LocalOutlierFactor(n_neighbors=20, contamination=0.01, novelty=True)
lof.fit(X_train)
anomaly_score = -lof.score_samples(X_test)
```
### Autoencoder reconstruction error (PyTorch)
```python
import torch.nn as nn
class AE(nn.Module):
def __init__(self, d=64):
super().__init__()
self.enc = nn.Sequential(nn.Linear(d,32), nn.ReLU(), nn.Linear(32,8))
self.dec = nn.Sequential(nn.Linear(8,32), nn.ReLU(), nn.Linear(32,d))
def forward(self, x): return self.dec(self.enc(x))
# 매 train on normal only — anomaly = high reconstruction error
recon = model(x)
score = ((x - recon) ** 2).mean(dim=1)
```
### EWMA streaming detector
```python
class EWMA:
def __init__(self, alpha=0.1, k=3.0):
self.alpha, self.k = alpha, k
self.mu = self.var = None
def step(self, x):
if self.mu is None: self.mu, self.var = x, 1.0; return False
z = abs(x - self.mu) / (self.var ** 0.5 + 1e-9)
self.mu = self.alpha * x + (1 - self.alpha) * self.mu
self.var = self.alpha * (x - self.mu)**2 + (1 - self.alpha) * self.var
return z > self.k
```
### PyOD ensemble
```python
from pyod.models.iforest import IForest
from pyod.models.lof import LOF
from pyod.models.combination import average
scores = np.column_stack([
IForest().fit(X).decision_function(X),
LOF().fit(X).decision_function(X),
])
ensemble_score = average(scores)
```
## 매 결정 기준
| 상황 | Algorithm |
|---|---|
| Tabular, low-dim | Isolation Forest |
| Tabular, density 중요 | LOF |
| Time-series univariate | EWMA / Prophet |
| Time-series multivariate | LSTM-AE / PatchTST |
| Image | PaDiM / PatchCore |
| Log sequence | LogBERT / DeepLog |
**기본값**: 매 Isolation Forest baseline → 부족시 deep model.
## 🔗 Graph
- 부모: [[Statistics & Data Analysis]]
- 변형: [[Inferential-Statistics]]
- 응용: [[Malware-Analysis]] · [[Deepfake-Detection]] · [[Logging_and_Error_Handling]]
- Adjacent: [[경고 피로 (Alert Fatigue)]]
## 🤖 LLM 활용
**언제**: log template 추출, anomaly explanation generation, false-positive triage.
**언제 X**: 매 high-frequency stream 의 inner-loop scoring (use specialized model).
## ❌ 안티패턴
- **Threshold hard-coding**: 매 environment drift 시 무용지물 — adaptive threshold 사용.
- **Class imbalance 무시**: 매 anomaly 0.1% 일 때 accuracy 99.9% 무의미 — PR-AUC.
- **Train on contaminated data**: 매 anomaly 가 train set 에 섞이면 mask 됨.
- **Alert fatigue**: 매 raw score 그대로 alert 면 dev 가 무시.
## 🧪 검증 / 중복
- Verified: Liu et al. 2008 (Isolation Forest); PyOD docs; Nie et al. 2023 (PatchTST).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — algorithm taxonomy + PyOD/AE patterns |
@@ -0,0 +1,148 @@
---
id: wiki-2026-0508-automated-quality-review
title: "Automated Quality & Review"
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Automated Code Review, AI Code Review, CR Automation]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [code-review, ci, devops, llm]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: TypeScript/Python
framework: GitHub Actions/Claude Code/Copilot
---
# Automated Quality & Review
## 매 한 줄
> **"매 PR 의 first reviewer 는 machine 이다."**. Automated Quality & Review 는 lint, type-check, test, SAST, AI review 를 PR pipeline 에 stack 하여 human reviewer 가 매 substance 만 보게 하는 매 modern engineering practice. 2026 의 stack: Biome + tsc + Vitest + Semgrep + Claude/Copilot review bot.
## 매 핵심
### 매 Quality Gate Layer
1. **Format**: Biome / Prettier — 매 zero-arg.
2. **Lint**: Biome / ESLint / Ruff — 매 style + likely-bug rules.
3. **Type**: tsc / mypy / pyright — 매 static contract.
4. **Test**: Vitest / Jest / pytest — 매 unit + integration.
5. **Coverage**: c8 / coverage.py — 매 80%+ delta enforced.
6. **SAST**: Semgrep / CodeQL — 매 security pattern.
7. **AI review**: Claude Code, Copilot Workspace, Cursor — 매 semantic.
8. **Mutation**: Stryker — 매 test quality 검증 (optional).
### 매 AI Review 2026 Capability
- **Logic bug detection**: Claude Opus 4.7 finds nil-deref, race, off-by-one.
- **Convention enforcement**: 매 codebase context 학습 후 style 위반 flag.
- **Security**: SQLi, XSS, IDOR, deserialization 의 dataflow 추적.
- **Performance**: N+1 query, O(n²) loop, unbounded recursion.
- **Test gap**: 매 코드 변경 vs test coverage delta 분석.
### 매 응용
1. PR comment bot — 매 inline suggestions.
2. Pre-merge gate — 매 critical issue block.
3. Refactor suggester — 매 nightly batch.
4. Onboarding — 매 junior dev 의 mentor.
## 💻 패턴
### GitHub Actions quality pipeline
```yaml
name: pr-quality
on: pull_request
jobs:
quality:
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
- uses: oven-sh/setup-bun@v2
- run: bun install --frozen-lockfile
- run: bun run biome check .
- run: bun run tsc --noEmit
- run: bun run vitest run --coverage
- uses: returntocorp/semgrep-action@v1
with: { config: 'p/owasp-top-ten' }
- uses: anthropics/claude-code-action@v1
with:
mode: review
model: claude-opus-4-7
```
### Claude Code review prompt
```markdown
You are reviewing PR #{number}. Focus on:
1. Logic bugs (off-by-one, null deref, race conditions)
2. Security (OWASP Top 10)
3. Performance (N+1, unbounded loops)
4. Test coverage for changed lines
Output format: file:line — severity — description.
Skip: style nits (handled by Biome).
```
### Reviewdog inline comment
```yaml
- run: bun run biome check --reporter=github . | reviewdog -f=github-check -reporter=github-pr-review
```
### Coverage delta gate
```yaml
- uses: ArtiomTr/jest-coverage-report-action@v2
with:
threshold: '{"lines":80,"branches":75}'
annotations: failed-tests
```
### Semgrep custom rule
```yaml
rules:
- id: hardcoded-secret
pattern-either:
- pattern: const $K = "$VAL"
metavariable-regex:
$K: '(?i)(api[_-]?key|secret|token|password)'
message: Hardcoded secret detected
severity: ERROR
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| TS/JS format+lint | Biome (single tool) |
| Python format+lint | Ruff |
| Type check | tsc strict / pyright strict |
| Security SAST | Semgrep + CodeQL |
| AI review | Claude Code Action |
| PR comment UX | reviewdog |
**기본값**: 매 Biome + tsc + Vitest + Semgrep + Claude review.
## 🔗 Graph
- 부모: [[CI_CD_Pipeline]]
- 변형: [[수동 코드 리뷰]] · [[자동화된 코드 리뷰]]
- 응용: [[SAST]] · [[Husky]] · [[lint-staged]]
- Adjacent: [[Engineering Metrics (DORA)]] · [[Test_Automation]]
## 🤖 LLM 활용
**언제**: PR review, refactor suggestion, test gap detection, commit message generation.
**언제 X**: 매 deterministic check (lint, type) — specialized tool 이 빠르고 정확.
## ❌ 안티패턴
- **AI-only review**: 매 human approval 없이 merge 허용 — accountability 사라짐.
- **Slow pipeline**: 매 30분 PR check 면 dev 가 우회. 5분 budget.
- **Style nit storm**: 매 AI 가 nit 만 쏟으면 중요한 logic bug 가 묻힘.
- **No fail-fast**: 매 lint fail 후에도 test 실행 — 매 sequential gate.
## 🧪 검증 / 중복
- Verified: GitHub Actions docs; Anthropic Claude Code docs; Semgrep playbook 2024.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — quality gate layers + Claude Code action |
@@ -0,0 +1,142 @@
---
id: wiki-2026-0508-bluf-bottom-line-up-front
title: BLUF (Bottom Line Up Front)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [a1b2c3d4-e5f6-4901-2e3f-4a5b6c7d8e9f, Bottom Line Up Front]
duplicate_of: none
source_trust_level: A
confidence_score: 1.0
verification_status: applied
tags: [communication, writing, devops, incident-response]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: markdown
framework: none
---
# BLUF (Bottom Line Up Front)
## 매 한 줄
> **"매 conclusion 을 첫 줄에 — recipient 가 더 못 읽어도 OK 하도록."**. US military origin 의 writing convention; 매 incident report, exec memo, PR description, on-call alert 의 표준 — 매 reader 의 cognitive load 를 minimize 하고 fastest decision-making 을 enable.
## 매 핵심
### 매 Structure
- **Line 1**: the conclusion / decision needed / status verdict.
- **Line 2-N**: supporting evidence in priority order.
- **Tail**: details, appendices, traces.
### 매 vs Narrative
- Narrative: "We started X, encountered Y, debugged Z, found root cause W, fixed it." — reader waits for punchline.
- BLUF: "Outage resolved. Root cause: misconfigured DNS. Restored 14:23 UTC." — punchline first.
### 매 응용
1. Incident postmortem TL;DR.
2. PR description first sentence.
3. Slack on-call escalation.
4. Email subject + first line.
5. Architecture decision record (ADR) summary.
## 💻 패턴
### Incident Slack Alert
```markdown
**[P1] Checkout API 5xx — DEGRADED**
Impact: 12% of orders failing since 14:05 UTC.
Action: rollback v2.4.1 in progress, ETA 5 min.
Owner: @oncall-payments
Thread: ↓
```
### Postmortem Top
```markdown
# Postmortem: 2026-05-08 Checkout Outage
**TL;DR**: 47-min P1 outage due to DNS TTL misconfig in v2.4.1 deploy.
- Customer impact: ~3,200 failed orders (~$84k revenue)
- Resolution: rollback at 14:23 UTC
- Action items: 4 (see §6)
## Timeline
...
```
### PR Description
```markdown
**Adds rate limiting to /api/checkout to prevent abuse.**
- New: `RateLimiter` middleware with Redis token bucket
- Default: 60 req/min per IP, configurable via env
- Tests: integration coverage for 429 path
- Risk: low — feature-flagged behind `RATE_LIMIT_ENABLED`
## Why
Spike on 05-06 saturated DB connections...
```
### Email Template
```markdown
Subject: [DECISION NEEDED by Fri] Migrate auth to OIDC — recommend Keycloak
Recommendation: adopt Keycloak for SSO; deprecate legacy LDAP by Q3.
Cost: $0 (OSS) + 2 SRE-weeks integration.
Risk: medium (auth migration); mitigated by phased rollout.
Background: ...
```
### ADR Header
```markdown
# ADR-0042: Use SQLite for local dev DB
**Decision**: SQLite for local; Postgres for staging/prod.
**Status**: accepted (2026-05-10)
**Context**: ... (3 paragraphs below)
```
### On-Call Status Page
```markdown
🟢 **All systems operational** — last incident 9 days ago.
Recent: deploys 4 (all green) · alerts 0 · SLO budget 99.4%
```
## 매 결정 기준
| 상황 | BLUF 적용 |
|---|---|
| Incident alert | YES — line 1 = severity + impact |
| Postmortem | YES — TL;DR block before timeline |
| Tutorial / explainer | NO — narrative 적합 |
| Marketing copy | NO — hook 후 reveal |
| ADR | YES — decision first |
| Bug report | YES — observed vs expected first |
**기본값**: ops/exec communication 은 BLUF; pedagogical/narrative 은 example-first.
## 🔗 Graph
- 부모: [[Technical Writing]]
- 응용: [[Postmortem]] · [[ADR]]
- Adjacent: [[Pyramid Principle]]
## 🤖 LLM 활용
**언제**: ask LLM to "rewrite as BLUF" — high-quality reflow.
**언제 X**: storytelling / customer-facing narrative.
## ❌ 안티패턴
- **Buried lede**: conclusion 을 §3 에 묻기.
- **Over-summarize**: line 1 이 vague ("there was an issue").
- **No context for novices**: BLUF 는 expert reader 가정 — onboarding doc 에는 부적합.
- **Decision-less BLUF**: "We did X" 보다 "Recommend Y" 가 actionable.
## 🧪 검증 / 중복
- Verified (US Army Field Manual, Google SRE Book postmortem chapter).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — full content with templates for incidents/PRs/ADRs |
@@ -0,0 +1,164 @@
---
id: wiki-2026-0508-bvh
title: BVH
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-D211FC, Bounding Volume Hierarchy]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [graphics, raytracing, datastructure, performance]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: rust
framework: none
---
# BVH
## 매 한 줄
> **"매 ray-object intersection 의 O(N) → O(log N) 변환의 표준 자료구조."**. Bounding Volume Hierarchy 는 ray tracing, collision detection, frustum culling 의 backbone — 매 modern path tracer (RTX, OptiX, Embree) 의 acceleration structure 핵심이며, SAH (Surface Area Heuristic) build 가 quality 의 standard.
## 매 핵심
### 매 Build Strategy
- **Median split**: simple, fast build, mediocre traversal.
- **SAH (Surface Area Heuristic)**: cost = traversal + leaf intersection, optimal quality.
- **HLBVH / LBVH**: GPU-friendly Morton-code build.
- **PLOC**: parallel locally-ordered clustering, modern GPU SOTA.
### 매 Traversal
- Stack-based DFS (CPU).
- Stackless / restart trail (GPU register-friendly).
- Wide BVH (BVH4, BVH8) — SIMD-friendly child arrays.
### 매 응용
1. Path tracing (Embree, OptiX, RTX hardware BVH).
2. Physics broadphase (Bullet, PhysX).
3. Three.js raycast acceleration (three-mesh-bvh).
4. WebGPU ray queries.
## 💻 패턴
### AABB Struct
```rust
#[derive(Copy, Clone)]
struct Aabb { min: [f32; 3], max: [f32; 3] }
impl Aabb {
fn surface_area(&self) -> f32 {
let d = [self.max[0]-self.min[0], self.max[1]-self.min[1], self.max[2]-self.min[2]];
2.0 * (d[0]*d[1] + d[1]*d[2] + d[2]*d[0])
}
fn union(a: Aabb, b: Aabb) -> Aabb {
Aabb {
min: [a.min[0].min(b.min[0]), a.min[1].min(b.min[1]), a.min[2].min(b.min[2])],
max: [a.max[0].max(b.max[0]), a.max[1].max(b.max[1]), a.max[2].max(b.max[2])],
}
}
}
```
### Slab Ray-AABB Test
```rust
fn ray_aabb(o: [f32;3], inv_d: [f32;3], box_: &Aabb) -> Option<f32> {
let mut tmin = 0.0_f32;
let mut tmax = f32::INFINITY;
for i in 0..3 {
let t1 = (box_.min[i] - o[i]) * inv_d[i];
let t2 = (box_.max[i] - o[i]) * inv_d[i];
tmin = tmin.max(t1.min(t2));
tmax = tmax.min(t1.max(t2));
}
if tmax >= tmin.max(0.0) { Some(tmin) } else { None }
}
```
### SAH Cost
```rust
fn sah_cost(left: &Aabb, n_left: usize, right: &Aabb, n_right: usize, parent: &Aabb) -> f32 {
const C_TRAV: f32 = 1.0;
const C_ISECT: f32 = 1.5;
let inv_pa = 1.0 / parent.surface_area();
C_TRAV + C_ISECT * (left.surface_area() * n_left as f32 + right.surface_area() * n_right as f32) * inv_pa
}
```
### Top-Down SAH Build (sketch)
```rust
fn build(prims: &mut [Prim]) -> Box<Node> {
if prims.len() <= 4 { return Box::new(Node::Leaf(prims.to_vec())); }
let (axis, split, _cost) = best_sah_split(prims);
prims.select_nth_unstable_by(split, |a, b| a.centroid[axis].partial_cmp(&b.centroid[axis]).unwrap());
let (l, r) = prims.split_at_mut(split);
Box::new(Node::Internal(build(l), build(r)))
}
```
### Stack Traversal
```rust
fn traverse(root: &Node, ray: &Ray) -> Option<Hit> {
let mut stack = vec![root];
let mut closest: Option<Hit> = None;
while let Some(n) = stack.pop() {
match n {
Node::Leaf(prims) => for p in prims { if let Some(h) = p.intersect(ray) { closest = Some(h.min_or(closest)); } },
Node::Internal(l, r) => { stack.push(r); stack.push(l); }
}
}
closest
}
```
### LBVH Morton Build
```rust
fn morton3d(x: u32, y: u32, z: u32) -> u32 {
fn spread(mut v: u32) -> u32 {
v = (v | v << 16) & 0x030000FF;
v = (v | v << 8) & 0x0300F00F;
v = (v | v << 4) & 0x030C30C3;
v = (v | v << 2) & 0x09249249;
v
}
spread(x) | (spread(y) << 1) | (spread(z) << 2)
}
```
## 매 결정 기준
| 상황 | BVH 변종 |
|---|---|
| Static scene, CPU PT | SAH BVH2 |
| Dynamic scene | Refit + occasional rebuild |
| GPU PT | Wide BVH (BVH4/8) + LBVH/PLOC |
| Animated chars | Two-level BVH (TLAS+BLAS) |
| Web (three.js) | three-mesh-bvh (SAH) |
**기본값**: SAH BVH2 for CPU; BVH8 + PLOC for GPU.
## 🔗 Graph
- 변형: [[KD-Tree]] · [[Octree]]
- 응용: [[Collision Detection]] · [[Frustum Culling]]
## 🤖 LLM 활용
**언제**: explain SAH math, generate boilerplate AABB/traversal code.
**언제 X**: micro-optimized SIMD/GPU BVH inner loop — needs profiler-driven tuning.
## ❌ 안티패턴
- **Median split for production PT**: 10-30% slower traversal vs SAH.
- **Recursive traversal on GPU**: stack overflow in registers — use iterative.
- **Refit-only forever**: quality degrades; periodic rebuild.
- **Per-triangle leaf**: cache-unfriendly; pack 4-8 prims/leaf.
## 🧪 검증 / 중복
- Verified (PBRT 4th ed, Embree paper, Wald 2007 SAH).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — full content with SAH/LBVH patterns |
@@ -0,0 +1,144 @@
---
id: wiki-2026-0508-backups
title: Backups
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Backup Strategy, Disaster Recovery, 백업]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [backup, dr, ops, sre]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Bash/Python
framework: restic/borg/AWS Backup
---
# Backups
## 매 한 줄
> **"매 backup 은 restore 가 검증된 backup 만이다."**. Backups 는 매 3-2-1 rule (3 copies, 2 media, 1 offsite) + RTO/RPO target + 정기 restore drill 의 trio. 2026 의 standard: incremental dedup (restic/borg) + immutable object lock (S3 Object Lock, Azure Immutable Blob) + ransomware-resistant air gap.
## 매 핵심
### 매 3-2-1-1-0 Rule (modern)
- **3** copies of data.
- **2** different media types.
- **1** offsite copy.
- **1** immutable / air-gapped (anti-ransomware, 매 2020+ 추가).
- **0** errors after restore verification.
### 매 RTO vs RPO
- **RTO (Recovery Time Objective)**: 매 outage 후 service 복구까지 허용 시간.
- **RPO (Recovery Point Objective)**: 매 허용 가능한 data loss window.
- 매 RTO=1h / RPO=15min 이면 hot standby 필요.
### 매 Backup Type
- **Full**: 매 전체 — slow, large, simple restore.
- **Incremental**: 매 since last backup — fast, smaller, restore chain.
- **Differential**: 매 since last full — middle ground.
- **Snapshot (CoW)**: 매 ZFS/btrfs/LVM/EBS — instant, space-efficient.
- **Continuous (CDC)**: 매 every transaction — Postgres WAL, MySQL binlog.
### 매 응용
1. DB backup (pg_basebackup + WAL archive).
2. File backup (restic, borg, Time Machine).
3. VM/disk snapshot (EBS, GCP PD, ZFS).
4. Object store replication (S3 CRR).
5. App-level (export-import, logical dump).
## 💻 패턴
### restic encrypted incremental backup
```bash
# 매 init repo (one-time)
restic init --repo s3:s3.amazonaws.com/my-backup-bucket
# 매 daily backup
restic -r s3:s3.amazonaws.com/my-backup-bucket backup /var/data \
--exclude '*.tmp' --tag daily --host $(hostname)
# 매 retention: keep 7d, 4w, 12m
restic forget --keep-daily 7 --keep-weekly 4 --keep-monthly 12 --prune
# 매 verify
restic check --read-data-subset=10%
```
### Postgres PITR setup
```bash
# postgresql.conf
wal_level = replica
archive_mode = on
archive_command = 'aws s3 cp %p s3://pg-wal/%f'
# 매 base backup
pg_basebackup -D /backup/base -Ft -z -P -U replicator
# 매 restore: recovery.conf or postgresql.auto.conf with restore_command + recovery_target_time
```
### S3 Object Lock (immutable, ransomware-proof)
```bash
aws s3api put-object-lock-configuration \
--bucket my-backup-bucket \
--object-lock-configuration '{"ObjectLockEnabled":"Enabled","Rule":{"DefaultRetention":{"Mode":"COMPLIANCE","Days":30}}}'
```
### Restore drill automation
```bash
#!/usr/bin/env bash
# 매 nightly drill — restore latest to scratch, verify checksums
set -euo pipefail
SCRATCH=$(mktemp -d)
restic -r s3:.../backup restore latest --target "$SCRATCH"
sha256sum -c expected_checksums.sha256 --strict
echo "drill ok: $(date -Iseconds)" | tee -a /var/log/restore-drill.log
rm -rf "$SCRATCH"
```
### ZFS snapshot + send
```bash
# 매 instant CoW snapshot
zfs snapshot tank/data@$(date +%Y%m%d-%H%M)
# 매 incremental send to remote
zfs send -i tank/data@yesterday tank/data@today | ssh backup-host zfs recv tank/data
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Files, small-mid | restic / borg |
| Postgres prod | pg_basebackup + WAL archive (PITR) |
| MySQL prod | xtrabackup + binlog |
| VM | snapshot + offsite replica |
| Multi-cloud | S3-compatible + CRR |
| Compliance (WORM) | S3 Object Lock COMPLIANCE mode |
**기본값**: 매 restic to S3 with Object Lock + nightly restore drill.
## 🔗 Graph
- 부모: [[SRE]]
- 변형: [[CI_CD_Pipeline]]
- 응용: [[카오스 몽키(Chaos Monkey)]]
- Adjacent: [[Secret_Management]] · [[Logging_and_Error_Handling]]
## 🤖 LLM 활용
**언제**: backup script generation, restore runbook drafting, log anomaly summarization.
**언제 X**: 매 actual restore execution — manual gate 필요.
## ❌ 안티패턴
- **No restore test**: 매 가장 흔한 실패 — backup 은 되는데 restore 가 안 됨.
- **Single copy**: 매 disk fail 한 방에 잃음.
- **No encryption**: 매 backup 이 attack vector — at-rest encrypt 필수.
- **No immutability**: 매 ransomware 가 backup 까지 암호화.
- **Forever retention**: 매 비용 폭발 + GDPR 위반 가능.
## 🧪 검증 / 중복
- Verified: restic docs; AWS Backup whitepaper; Veeam 3-2-1-1-0 guide; PostgreSQL PITR docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — 3-2-1-1-0 + restic/PG PITR/S3 Object Lock |
@@ -0,0 +1,32 @@
---
id: wiki-2026-0508-batchedmesh-및-instancedmesh-성능-벤
title: BatchedMesh 및 InstancedMesh 성능 벤치마크
category: 10_Wiki/Topics
status: duplicate
canonical_id: batchedmesh-instancedmesh
duplicate_of: "[[BatchedMesh and InstancedMesh Performance]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, threejs, webgl, performance]
last_reinforced: 2026-05-10
github_commit: pending
---
# BatchedMesh 및 InstancedMesh 성능 벤치마크
> **이 문서는 [[BatchedMesh and InstancedMesh Performance]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (specialization aspects, optional)
- Three.js r158+ 의 BatchedMesh — 매 multi-draw indirect 활용.
- InstancedMesh — 동일 geometry 의 GPU instancing.
- Draw call 절감 = 매 frame budget 의 핵심.
## 🔗 Graph
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,32 @@
---
id: wiki-2026-0508-beat-saber-엑서게임-연구-beat-saber-ex
title: Beat Saber 엑서게임 연구(Beat Saber Exergaming Study)
category: 10_Wiki/Topics
status: duplicate
canonical_id: beat-saber-exergaming
duplicate_of: "[[Beat Saber Exergaming]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, vr, exergaming, health]
last_reinforced: 2026-05-10
github_commit: pending
---
# Beat Saber 엑서게임 연구(Beat Saber Exergaming Study)
> **이 문서는 [[Beat Saber Exergaming]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (specialization aspects, optional)
- VR rhythm game 의 cardiovascular load — moderate-to-vigorous intensity.
- Adherence 가 traditional exercise 보다 높음 (gamification effect).
- Energy expenditure 5-8 METs (Expert+ 난이도).
## 🔗 Graph
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,32 @@
---
id: wiki-2026-0508-beat-saber를-활용한-vr-엑서게임-후유증-연구-v
title: Beat Saber를 활용한 VR 엑서게임 후유증 연구(VR Exergaming Aftereffects)
category: 10_Wiki/Topics
status: duplicate
canonical_id: vr-exergaming-aftereffects
duplicate_of: "[[VR Exergaming Aftereffects]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, vr, exergaming, cybersickness]
last_reinforced: 2026-05-10
github_commit: pending
---
# Beat Saber를 활용한 VR 엑서게임 후유증 연구(VR Exergaming Aftereffects)
> **이 문서는 [[VR Exergaming Aftereffects]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (specialization aspects, optional)
- Post-VR aftereffects: balance disruption, eye strain, cognitive fatigue.
- Cybersickness scores (SSQ) post-session.
- Recovery timeline — typically 10-30 min for mild cases.
## 🔗 Graph
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,140 @@
---
id: wiki-2026-0508-bioinformatics-structure-predict
title: Bioinformatics Structure Prediction
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Protein Structure Prediction, AlphaFold, ESM]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [bioinformatics, ml, protein, structure]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Python
framework: AlphaFold3/ESM3/ColabFold
---
# Bioinformatics Structure Prediction
## 매 한 줄
> **"매 sequence 에서 3D 구조까지 — 50년 grand challenge 가 2021 년 풀렸다."**. AlphaFold2 (2021) 가 CASP14 에서 experimental accuracy 달성, AlphaFold3 (2024) 가 protein-ligand-NA complex 까지 확장, ESM3 (2024) 가 generative protein design 시대를 열었다. 2026 의 표준: AF3 + ESMFold + RoseTTAFold All-Atom + ColabFold pipeline.
## 매 핵심
### 매 Method Lineage
- **Homology modeling** (1990s): MODELLER — known template 의존.
- **Threading / fold recognition** (2000s).
- **Ab initio physics** (Rosetta).
- **Coevolution + DL** (2018+): trRosetta, AlphaFold1.
- **Attention-based** (2021+): AlphaFold2 — Evoformer + Structure module.
- **All-atom diffusion** (2024+): AlphaFold3 — protein/DNA/RNA/ligand 통합.
- **Single-sequence (LLM)**: ESMFold, ESM3 — 매 MSA 없이 fast.
### 매 AlphaFold3 Capability (2024)
- 매 protein-protein, protein-NA, protein-ligand complex.
- 매 covalent modifications, ions.
- 매 diffusion-based all-atom output.
- 매 license: research-only via AF Server.
### 매 응용
1. **Drug discovery**: target-ligand docking, hit triage.
2. **Protein engineering**: enzyme design, antibody.
3. **Disease mechanism**: variant effect (missense3D, AlphaMissense).
4. **Structural biology**: cryo-EM model building.
5. **De novo design**: RFdiffusion + ProteinMPNN.
## 💻 패턴
### ColabFold one-liner
```bash
# 매 fast MSA via MMseqs2 + AF2 inference
colabfold_batch input.fasta out_dir/ \
--num-recycle 3 --model-type alphafold2_multimer_v3
```
### ESMFold (single-sequence, no MSA)
```python
import torch
from transformers import EsmForProteinFolding
model = EsmForProteinFolding.from_pretrained("facebook/esmfold_v1").cuda().eval()
seq = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVK"
with torch.no_grad():
out = model.infer_pdb(seq)
open("pred.pdb","w").write(out)
```
### AlphaFold3 via API
```python
# 매 AF3 server (research) — JSON job spec
import requests
job = {
"name": "complex_001",
"modelSeeds": [42],
"sequences": [
{"protein": {"id":"A","sequence":"MKTA..."}},
{"ligand": {"id":"L","ccdCodes":["ATP"]}}
]
}
r = requests.post("https://alphafoldserver.com/api/job", json=job, headers=auth)
```
### RFdiffusion de novo binder design
```bash
# 매 design 80aa binder against target hotspot
python run_inference.py \
inference.output_prefix=binders/run \
contigmap.contigs="['A1-150,0 80-80']" \
ppi.hotspot_res="['A30','A33','A56']" \
inference.num_designs=100
```
### Confidence (pLDDT) filtering
```python
import numpy as np
# 매 pLDDT > 90 = very high; 70-90 = confident; 50-70 = low; <50 = disordered
plddt = np.array([atom.bfactor for atom in structure.get_atoms() if atom.name == "CA"])
mean_conf = plddt.mean()
disordered_frac = (plddt < 50).mean()
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| Single protein, fast | ESMFold |
| Single protein, accurate | AlphaFold2 (ColabFold) |
| Multimer / complex | AlphaFold3 / AF-Multimer |
| Protein + ligand | AlphaFold3 / Boltz-1 |
| De novo design | RFdiffusion + ProteinMPNN |
| Variant effect | AlphaMissense |
**기본값**: 매 ColabFold AF2-multimer → AF3 for ligand/NA.
## 🔗 Graph
- 부모: [[Statistics & Data Analysis]]
- 변형: [[Anomaly-Detection]]
- 응용: [[Practical-Cryptography]]
- Adjacent: [[Inferential-Statistics]]
## 🤖 LLM 활용
**언제**: protein language model embedding, binder search, paper summary, mutation scan ranking.
**언제 X**: 매 final pose prediction — physics/structure model 이 specialized.
## ❌ 안티패턴
- **pLDDT 무시**: 매 low-confidence region 을 그대로 사용 — 매 disordered 일 수 있음.
- **Single seed**: 매 AF3 multi-seed sampling 권장 — diversity.
- **MSA 없이 large complex**: 매 ESMFold 는 single-chain 강점, multimer 약함.
- **License 위반**: 매 AF3 weights non-commercial — server API 만 허용.
## 🧪 검증 / 중복
- Verified: Jumper et al. 2021 Nature (AF2); Abramson et al. 2024 Nature (AF3); Lin et al. 2023 Science (ESM2).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — AF3/ESM3/RFdiffusion 2026 stack |
@@ -0,0 +1,148 @@
---
id: wiki-2026-0508-blink
title: Blink
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-7F733B, Chromium Blink, Blink Renderer]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [browser, web, rendering, chromium]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: cpp
framework: chromium
---
# Blink
## 매 한 줄
> **"매 Chromium 의 rendering engine — 매 Web 의 de facto standard."**. Blink 는 Google 이 2013 년 WebKit 에서 fork 한 layout/rendering engine 으로, Chrome/Edge/Brave/Opera 등 Chromium-based browser 의 90%+ market share 를 통해 매 modern web platform (CSS Grid, Houdini, View Transitions) 을 정의한다.
## 매 핵심
### 매 Pipeline
1. **Parse** — HTML/CSS → DOM/CSSOM.
2. **Style** — selector matching, computed style.
3. **Layout (LayoutNG)** — box tree, fragment tree.
4. **Paint** — display item list.
5. **Composite (CC)** — layer tree → GPU draw quads.
6. **Raster + Display** — Skia/SkiaGanesh → Viz → Display compositor.
### 매 vs WebKit / Gecko
- **Blink (Chromium)**: V8, Skia, multi-process.
- **WebKit (Safari)**: JavaScriptCore, CoreGraphics/Metal.
- **Gecko (Firefox)**: SpiderMonkey, WebRender (Rust).
### 매 응용
1. Chrome/Edge browsers.
2. Electron/Tauri (Tauri uses platform webview).
3. CEF (Chromium Embedded Framework).
4. Headless Chrome / Puppeteer / Playwright.
## 💻 패턴
### Custom Element via Web Components
```javascript
class MyButton extends HTMLElement {
connectedCallback() {
this.attachShadow({ mode: "open" }).innerHTML = `
<button><slot></slot></button>
<style>button { padding: 8px 16px; }</style>`;
}
}
customElements.define("my-button", MyButton);
```
### CSS Houdini Paint Worklet
```javascript
// checkerboard.js
class Checkerboard {
paint(ctx, geom, props) {
const size = props.get("--check-size").value;
for (let y = 0; y < geom.height; y += size)
for (let x = 0; x < geom.width; x += size)
if (((x/size) + (y/size)) % 2) ctx.fillRect(x, y, size, size);
}
}
registerPaint("checkerboard", Checkerboard);
```
```css
div { background: paint(checkerboard); --check-size: 20; }
```
### View Transitions (Blink 111+)
```javascript
async function navigate(url) {
if (!document.startViewTransition) return location.assign(url);
const t = document.startViewTransition(() => loadInto(url));
await t.finished;
}
```
### Performance: Containment
```css
.card {
contain: layout paint style; /* isolate subtree work */
content-visibility: auto; /* skip offscreen rendering */
}
```
### DevTools Trace (Programmatic)
```javascript
// puppeteer
const browser = await puppeteer.launch();
const page = await browser.newPage();
await page.tracing.start({ path: "trace.json", categories: ["devtools.timeline"] });
await page.goto("https://example.com");
await page.tracing.stop();
```
### CDP (Chrome DevTools Protocol)
```javascript
const client = await page.target().createCDPSession();
await client.send("Performance.enable");
const { metrics } = await client.send("Performance.getMetrics");
console.log(metrics.find(m => m.name === "LayoutCount"));
```
## 매 결정 기준
| 상황 | 권장 |
|---|---|
| Cross-browser web app | Standards-only, test 3 engines |
| Desktop app (full Chromium) | Electron/CEF |
| Lightweight desktop | Tauri (system webview) |
| Automation/scrape | Playwright (multi-engine) |
| Mobile WebView | System WebView (avoid bundling) |
**기본값**: standards + feature detection; Blink-specific API only with fallbacks.
## 🔗 Graph
- 부모: [[Chromium]]
- 변형: [[WebKit]]
- 응용: [[Electron]] · [[Playwright]]
- Adjacent: [[V8]] · [[Skia]]
## 🤖 LLM 활용
**언제**: explain pipeline stage, generate web platform boilerplate.
**언제 X**: Blink internals C++ patches — need source + CL review.
## ❌ 안티패턴
- **Vendor-prefixed only**: `-webkit-` without standard fallback.
- **Layout thrashing**: read-write-read forced sync layouts.
- **Heavy main thread**: blocks composite — use Workers + OffscreenCanvas.
- **Assuming Chromium-only**: breaks Safari/Firefox parity.
## 🧪 검증 / 중복
- Verified (chromium.org docs, web.dev, Blink design docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — pipeline, Houdini, View Transitions |
@@ -0,0 +1,165 @@
---
id: wiki-2026-0508-blog-post
title: Blog Post
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Engineering Blog, Tech Writing]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [writing, content, devrel]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Markdown/MDX
framework: Astro/Next.js/Hugo
---
# Blog Post
## 매 한 줄
> **"매 잘 쓴 한 글이 1000번의 회의를 대체한다."**. Engineering blog post 는 매 internal knowledge 를 외부 (recruiting, brand, community) 와 미래 자신 에게 publish 하는 매 leveraged artifact. 2026 의 stack: Astro/Next.js + MDX + algolia search + RSS + open-graph + Schema.org + AI-generated TL;DR.
## 매 핵심
### 매 Strong Post 의 Anatomy
- **Hook**: 매 첫 두 문장 — problem + stake.
- **TL;DR / BLUF**: 매 결론 먼저.
- **Concrete numbers**: 매 "20% faster" not "much faster".
- **Code that runs**: 매 copy-pasteable, working snippet.
- **Diagrams**: 매 system 그림이 단어 100개를 대체.
- **Honest tradeoffs**: 매 안 좋은 점도 적기.
- **Sources**: 매 reference link.
### 매 Format Type
- **Tutorial**: 매 step-by-step, runnable.
- **Reference**: 매 spec-like.
- **Explainer / mental-model**: 매 "왜".
- **Postmortem**: 매 incident retrospective.
- **Decision record (ADR)**: 매 trade-off 기록.
- **Benchmark**: 매 measure + reproduce.
### 매 Stack 2026
- **Authoring**: MDX, code blocks with shiki/Prism, KaTeX math.
- **SSG**: Astro, Next.js, Hugo, Eleventy.
- **Hosting**: Vercel, Cloudflare Pages, Netlify, GitHub Pages.
- **Analytics**: Plausible, Fathom (privacy-friendly).
- **Feedback**: Giscus (GitHub Discussions).
### 매 응용
1. Engineering blog (Stripe, Cloudflare, Vercel style).
2. Personal site (Notion-style or Astro).
3. Internal wiki post.
4. Conference talk companion.
5. Open-source project announcement.
## 💻 패턴
### Astro + MDX setup
```bash
bun create astro@latest my-blog -- --template blog --typescript strict
cd my-blog && bunx astro add mdx sitemap
```
### Frontmatter schema (zod-validated)
```typescript
// src/content/config.ts
import { defineCollection, z } from 'astro:content';
export const collections = {
blog: defineCollection({
type: 'content',
schema: z.object({
title: z.string().max(70),
pubDate: z.coerce.date(),
tags: z.array(z.string()),
heroImage: z.string().optional(),
tldr: z.string().min(40).max(280),
}),
}),
};
```
### Code block with shiki + line highlight
````mdx
```ts {3-5}
function fib(n: number): number {
if (n < 2) return n;
// 매 highlighted recursion
return fib(n-1) + fib(n-2);
}
```
````
### Open Graph + JSON-LD
```html
<meta property="og:title" content={post.title}>
<meta property="og:description" content={post.tldr}>
<meta property="og:image" content={`https://blog.example.com/og/${post.slug}.png`}>
<script type="application/ld+json">{JSON.stringify({
"@context":"https://schema.org",
"@type":"BlogPosting",
"headline": post.title,
"datePublished": post.pubDate.toISOString(),
})}</script>
```
### Auto-generated OG image (Vercel OG)
```typescript
// pages/og/[slug].tsx
import { ImageResponse } from '@vercel/og';
export default function og(req) {
const title = new URL(req.url).searchParams.get('title');
return new ImageResponse(<div style={{fontSize:64,padding:80}}>{title}</div>, { width:1200, height:630 });
}
```
### TL;DR via LLM (build-time)
```typescript
// 매 build hook — generate 280-char summary
const tldr = await anthropic.messages.create({
model: 'claude-haiku-4',
max_tokens: 200,
messages: [{ role:'user', content:`Summarize in 2 sentences:\n\n${markdown}` }],
});
```
## 매 결정 기준
| 상황 | SSG |
|---|---|
| Content-heavy, fast | Astro |
| React stack, ISR | Next.js |
| Maximum simplicity | Hugo / Eleventy |
| Notion-style | Notion + Super |
| Self-host | Ghost |
**기본값**: 매 Astro + MDX + Vercel/Cloudflare Pages.
## 🔗 Graph
- 부모: [[Continuous-Discovery]]
- 변형: [[BLUF (Bottom Line Up Front)]]
- 응용: [[MECE Principle]]
- Adjacent: [[Edtech-Industry-Trends]]
## 🤖 LLM 활용
**언제**: TL;DR 생성, alt-text, SEO meta description, draft outline.
**언제 X**: 매 fact claim — 매 verify 안 한 LLM output 은 hallucination 위험.
## ❌ 안티패턴
- **Wall of text**: 매 heading + list 없이는 skim 불가.
- **Pseudocode only**: 매 reader 가 실행 못 함.
- **No metrics**: 매 "faster, better" 만 — concrete 숫자 필요.
- **Stale code**: 매 deprecated API 사용.
- **No date**: 매 reader 가 freshness 판단 불가.
## 🧪 검증 / 중복
- Verified: web.dev SEO docs; Schema.org BlogPosting; Astro docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — anatomy + Astro/MDX/OG patterns |
@@ -0,0 +1,145 @@
---
id: wiki-2026-0508-branch-prediction
title: Branch Prediction
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-4D7707, CPU Branch Predictor]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [cpu, performance, security, microarchitecture]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: cpp
framework: none
---
# Branch Prediction
## 매 한 줄
> **"매 modern CPU 의 IPC 핵심 mechanism — 그리고 Spectre 의 attack surface."**. Branch predictor 는 conditional/indirect branch 의 결과를 speculatively execute 함으로써 deep pipeline 의 stall 을 회피; 매 misprediction penalty 는 15-20+ cycles, 매 mispredicted speculative window 가 Spectre v1/v2 의 leak vector.
## 매 핵심
### 매 Predictor 종류
- **Static**: forward-not-taken, backward-taken (hint).
- **Bimodal (2-bit)**: per-PC saturating counter.
- **Local history**: per-branch shift register.
- **Global history (gshare/GAg)**: shared GHR XOR PC.
- **Tournament**: meta-predictor selects local vs global.
- **TAGE / ITTAGE**: tagged geometric history (modern SOTA).
- **Perceptron**: AMD Zen — neural-style predictor.
### 매 Indirect Branches
- BTB (Branch Target Buffer) — caches target.
- ITTAGE for indirect.
- Critical for vtables, function pointers, switch.
### 매 응용
1. Hot loops — predictable branches → near-zero penalty.
2. Sorted-data effect (the famous SO question).
3. Spectre/BranchScope side-channel attacks.
4. JIT branch ordering decisions (V8, Hotspot).
## 💻 패턴
### Likely / Unlikely Hints (C++20)
```cpp
if (x > 0) [[likely]] {
fast_path();
} else [[unlikely]] {
slow_path();
}
```
### Branchless via Mask
```cpp
// branchful
int abs_v(int x) { return x < 0 ? -x : x; }
// branchless
int abs_v_nb(int x) {
int mask = x >> 31; // 0 or -1
return (x ^ mask) - mask;
}
```
### Branchless Min via cmov
```cpp
int min_v(int a, int b) {
return a < b ? a : b; // compilers emit cmov on x86
}
```
### Sort Before Loop (classic)
```cpp
std::sort(data.begin(), data.end()); // 정렬 → branch predictable
long sum = 0;
for (int v : data) if (v >= 128) sum += v;
```
### LLVM `__builtin_expect`
```cpp
if (__builtin_expect(error_flag, 0)) {
handle_error();
}
```
### Spectre v1 Mitigation (lfence)
```cpp
// vulnerable
if (idx < arr_size) {
secret = arr[idx]; // mispredict → leaks
}
// hardened
if (idx < arr_size) {
asm volatile("lfence" ::: "memory");
secret = arr[idx];
}
```
### perf Branch Stats
```bash
perf stat -e branches,branch-misses ./bench
# branch-miss rate > 5% → suspect; > 10% → critical
```
## 매 결정 기준
| 상황 | 전략 |
|---|---|
| Hot loop, predictable | Trust predictor — natural code |
| Hot loop, unpredictable | Branchless / mask / cmov |
| Cold path | Doesn't matter — clarity > tricks |
| Indirect-heavy (vtable) | Devirtualize, monomorphize |
| Security-sensitive | lfence / speculative load hardening |
**기본값**: write clear branchful code; branchless only when profiler shows misprediction hotspot.
## 🔗 Graph
- 부모: [[Pipeline]]
- 응용: [[JIT Compilation]]
- Adjacent: [[Spectre]] · [[Speculative Execution]]
## 🤖 LLM 활용
**언제**: explain mispredict cost, generate branchless equivalents, suggest hints.
**언제 X**: micro-arch tuning without perf data — speculation hurts.
## ❌ 안티패턴
- **Random unpredictable branch in hot loop**: 20-30% slowdown.
- **Premature branchless conversion**: hurts cold/clarity paths.
- **Trusting `[[likely]]` blindly**: PGO data > human guess.
- **Ignoring Spectre in untrusted-input parsers**: real CVE risk.
## 🧪 검증 / 중복
- Verified (Hennessy & Patterson 6th, Agner Fog optimization manuals, Intel SDM).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — predictor types, branchless patterns, Spectre |
@@ -0,0 +1,160 @@
---
id: wiki-2026-0508-buffergeometry
title: BufferGeometry
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-2887C6, Three.js BufferGeometry]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [graphics, threejs, webgl, performance]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: javascript
framework: three.js
---
# BufferGeometry
## 매 한 줄
> **"매 Three.js 의 GPU-resident geometry container — 매 modern Three 의 only geometry class."**. BufferGeometry 는 typed-array 기반 attribute (position, normal, uv, index) 의 GPU upload 를 직접 관리하며, 매 Geometry class deprecation (r125) 이후 표준 — instancing/batching/morph 의 backbone.
## 매 핵심
### 매 Attribute
- **Position** (Float32Array, itemSize=3): vertex coords.
- **Normal** (Float32Array, itemSize=3).
- **UV** (Float32Array, itemSize=2).
- **Index** (Uint16/Uint32Array): triangle list.
- **Custom**: any vertex attribute (color, tangent, instance data).
### 매 Update Strategy
- **Static**: upload once, never modify (default).
- **Dynamic** (`setUsage(DynamicDrawUsage)`): frequent CPU update.
- **Stream**: per-frame update (rare).
### 매 응용
1. Custom shaders with custom attributes.
2. GPU instancing (InstancedBufferAttribute).
3. Procedural geometry generation.
4. Mesh deformation / morphing.
5. GPGPU particle systems.
## 💻 패턴
### Manual Triangle
```javascript
import * as THREE from "three";
const geo = new THREE.BufferGeometry();
const positions = new Float32Array([
0, 1, 0,
-1, -1, 0,
1, -1, 0,
]);
geo.setAttribute("position", new THREE.BufferAttribute(positions, 3));
geo.computeVertexNormals();
```
### Indexed Quad
```javascript
const positions = new Float32Array([-1,-1,0, 1,-1,0, 1,1,0, -1,1,0]);
const indices = new Uint16Array([0, 1, 2, 0, 2, 3]);
const geo = new THREE.BufferGeometry();
geo.setAttribute("position", new THREE.BufferAttribute(positions, 3));
geo.setIndex(new THREE.BufferAttribute(indices, 1));
```
### Dynamic Vertex Update
```javascript
const attr = geo.attributes.position;
attr.setUsage(THREE.DynamicDrawUsage);
function tick(t) {
for (let i = 0; i < attr.count; i++) {
attr.setY(i, Math.sin(t + i * 0.1));
}
attr.needsUpdate = true;
}
```
### Custom Shader Attribute
```javascript
const aRandom = new Float32Array(geo.attributes.position.count);
for (let i = 0; i < aRandom.length; i++) aRandom[i] = Math.random();
geo.setAttribute("aRandom", new THREE.BufferAttribute(aRandom, 1));
const mat = new THREE.ShaderMaterial({
vertexShader: `attribute float aRandom; varying float vR;
void main(){ vR=aRandom; gl_Position=projectionMatrix*modelViewMatrix*vec4(position,1.); }`,
fragmentShader: `varying float vR; void main(){ gl_FragColor=vec4(vR,vR,vR,1.); }`,
});
```
### Instanced Attribute
```javascript
const N = 10000;
const offsets = new Float32Array(N * 3);
for (let i = 0; i < N; i++) {
offsets[i*3] = (Math.random()-0.5)*100;
offsets[i*3+1] = (Math.random()-0.5)*100;
offsets[i*3+2] = (Math.random()-0.5)*100;
}
const igeo = new THREE.InstancedBufferGeometry().copy(geo);
igeo.instanceCount = N;
igeo.setAttribute("aOffset", new THREE.InstancedBufferAttribute(offsets, 3));
```
### Merge Geometries
```javascript
import { mergeGeometries } from "three/addons/utils/BufferGeometryUtils.js";
const merged = mergeGeometries([geoA, geoB, geoC], false);
// single draw call instead of three
```
### Bounding Volume Recompute
```javascript
geo.computeBoundingBox();
geo.computeBoundingSphere(); // required for frustum culling after vertex moves
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Static mesh | StaticDrawUsage (default) |
| Per-frame deform | DynamicDrawUsage + needsUpdate |
| Many copies | InstancedBufferGeometry |
| Many distinct meshes | mergeGeometries or BatchedMesh |
| Massive points | BufferGeometry + Points + custom shader |
**기본값**: static indexed BufferGeometry; switch to instanced/merged for >100 copies.
## 🔗 Graph
- 부모: [[Three.js]]
- 변형: [[BatchedMesh]]
- Adjacent: [[BufferAttribute]]
## 🤖 LLM 활용
**언제**: generate procedural geometry boilerplate, debug attribute layout.
**언제 X**: micro-optimization of custom shaders without profiling.
## ❌ 안티패턴
- **Forgetting `needsUpdate = true`**: GPU never re-uploads.
- **Recreating BufferGeometry per frame**: GC pressure — mutate in place.
- **Float32 indices**: not supported — use Uint16/Uint32.
- **No bounding sphere recompute**: frustum-culled erroneously after deform.
## 🧪 검증 / 중복
- Verified (three.js r170 docs, threejs-journey).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — attributes, dynamic update, instancing patterns |
@@ -0,0 +1,32 @@
---
id: wiki-2026-0508-cantab-5-선택-반응-시간-과제-cantab-5-ch
title: CANTAB 5-선택 반응 시간 과제(CANTAB 5-choice RTI)
category: 10_Wiki/Topics
status: duplicate
canonical_id: cantab-5-choice-rti
duplicate_of: "[[CANTAB 5-Choice RTI]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, neuropsychology, cognition, assessment]
last_reinforced: 2026-05-10
github_commit: pending
---
# CANTAB 5-선택 반응 시간 과제(CANTAB 5-choice RTI)
> **이 문서는 [[CANTAB 5-Choice RTI]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (specialization aspects, optional)
- Cambridge Neuropsychological Test Automated Battery (CANTAB) 의 5-choice reaction time task.
- Movement time + reaction time 의 분리 측정.
- 임상: ADHD, dementia, TBI 의 attention/processing speed assessment.
## 🔗 Graph
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,163 @@
---
id: wiki-2026-0508-ci-cd-pipeline
title: CI CD Pipeline
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Continuous Integration / Delivery Pipeline, Build Pipeline]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [ci, cd, devops, pipeline]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: YAML
framework: GitHub Actions/GitLab CI/Buildkite
---
# CI CD Pipeline
## 매 한 줄
> **"매 commit 이 production 까지 도달하는 자동 경로가 CI/CD pipeline."**. Pipeline 은 build → test → security → package → deploy → verify 의 매 ordered DAG. 2026 의 표준: GitHub Actions reusable workflow + OIDC 기반 cloud auth + supply-chain attestation (SLSA L3) + progressive delivery (Argo Rollouts/Flagger).
## 매 핵심
### 매 Pipeline Stage
1. **Source**: trigger on PR / push / tag.
2. **Build**: deterministic, hermetic — Bazel/Nx cache.
3. **Test**: unit / integration / e2e — parallel shards.
4. **Security**: SAST (Semgrep), SCA (Trivy), secret scan.
5. **Package**: container, helm chart, npm — sign (cosign).
6. **Attest**: SBOM (Syft) + SLSA provenance.
7. **Deploy**: env-progressive (dev → staging → prod).
8. **Verify**: smoke, canary metrics, auto-rollback.
### 매 Modern Best Practices 2026
- **OIDC over long-lived secrets** (GitHub OIDC → AWS/GCP).
- **Reusable workflows** — DRY across repos.
- **Matrix sharding** — test parallelism.
- **Cache layers** — Turborepo, Nx, Bazel remote cache.
- **Progressive delivery** — canary, blue/green, feature flags.
- **GitOps** — Argo CD / Flux — git as source of truth.
- **Supply chain** — Sigstore cosign, SLSA L3 attestation.
### 매 응용
1. SaaS web app deploy.
2. Library publish (npm, PyPI, Maven).
3. Container image release.
4. Mobile (Fastlane).
5. ML model deploy (MLOps).
## 💻 패턴
### GitHub Actions reusable workflow
```yaml
# .github/workflows/ci.yml
on: [pull_request, push]
permissions:
contents: read
id-token: write # 매 OIDC
jobs:
test:
uses: org/.github/.github/workflows/ts-ci.yml@v1
with:
node-version: '22'
deploy:
needs: test
if: github.ref == 'refs/heads/main'
uses: org/.github/.github/workflows/deploy.yml@v1
with:
env: prod
```
### OIDC to AWS (no long-lived keys)
```yaml
- uses: aws-actions/configure-aws-credentials@v4
with:
role-to-assume: arn:aws:iam::123:role/gha-deployer
aws-region: us-east-1
- run: aws s3 sync ./dist s3://my-bucket
```
### Matrix test sharding
```yaml
strategy:
matrix:
shard: [1, 2, 3, 4]
steps:
- run: bun run vitest run --shard=${{ matrix.shard }}/4
```
### Container build + sign + SBOM
```yaml
- uses: docker/build-push-action@v6
id: build
with: { tags: ghcr.io/org/app:${{ github.sha }}, push: true }
- uses: anchore/sbom-action@v0
with: { image: ghcr.io/org/app:${{ github.sha }}, format: spdx-json }
- uses: sigstore/cosign-installer@v3
- run: cosign sign --yes ghcr.io/org/app@${{ steps.build.outputs.digest }}
```
### Argo Rollouts canary
```yaml
apiVersion: argoproj.io/v1alpha1
kind: Rollout
spec:
strategy:
canary:
steps:
- setWeight: 10
- pause: { duration: 5m }
- analysis: { templates: [{ templateName: error-rate }] }
- setWeight: 50
- pause: { duration: 10m }
- setWeight: 100
```
### Turborepo remote cache
```bash
# 매 first build seeds cache; later runs hit
TURBO_TOKEN=$REMOTE_TOKEN TURBO_TEAM=acme bunx turbo run build --remote-cache-timeout=60
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| OSS / GitHub repo | GitHub Actions |
| GitLab native | GitLab CI |
| Monorepo many pipelines | Buildkite / Dagger |
| K8s GitOps | Argo CD + Argo Rollouts |
| Multi-cloud workflow | Dagger / Earthly |
**기본값**: 매 GitHub Actions + OIDC + reusable workflow + Argo Rollouts.
## 🔗 Graph
- 부모: [[Continuous Integration (지속적 통합, CI)]] · [[Continuous Delivery (지속적 제공, CD)]]
- 변형: [[지속적 통합 (CI) 및 지속적 배포 (CD)]]
- 응용: [[Engineering Metrics (DORA)]] · [[Feature-Flags]]
- Adjacent: [[Husky]] · [[Test_Automation]] · [[Secret_Management]]
## 🤖 LLM 활용
**언제**: workflow YAML drafting, failed-build log triage, retry-storm root-cause.
**언제 X**: 매 deterministic step (lint/test) — pipeline 자체가 검증.
## ❌ 안티패턴
- **Long-lived AWS keys in secret**: 매 OIDC 사용.
- **`if: always()` 남용**: 매 fail 무시 — 신뢰 무너짐.
- **No cache**: 매 매 build 30분.
- **Single-stage everything**: 매 fail-fast 설계 안 됨.
- **No staging**: 매 직접 prod — rollback 어려움.
## 🧪 검증 / 중복
- Verified: GitHub Actions docs; SLSA spec v1.0; Argo Rollouts docs; DORA report 2024.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — pipeline stages + OIDC/SLSA/canary |
@@ -0,0 +1,158 @@
---
id: wiki-2026-0508-cpu-bottleneck
title: CPU Bottleneck
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [CPU-Bound, Compute Bottleneck]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [performance, profiling, cpu]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: C++/Rust/JS
framework: perf/Instruments/Chrome DevTools
---
# CPU Bottleneck
## 매 한 줄
> **"매 GPU 가 놀고 main thread 가 100% 면 CPU bottleneck."**. CPU bottleneck 은 frame budget 16.7ms (60fps) 또는 11ms (90fps XR) 안에 main thread 작업이 안 끝나는 상태. 2026 진단: Chrome Performance panel + perf + Instruments → fix: WebWorker / WASM SIMD / off-main-thread / batching.
## 매 핵심
### 매 진단 신호
- GPU utilization < 70% but FPS drop.
- Long Task > 50ms in Performance panel.
- `perf top` 의 single function 이 hot.
- Profile 의 self-time 이 한 함수에 집중.
### 매 Bottleneck Source
- **Main-thread JS**: parse, layout, large loop.
- **Layout thrash**: read-write-read DOM.
- **GC pause**: allocation pressure.
- **Synchronous IO**: blocking syscall.
- **Unoptimized algorithm**: O(n²) on hot path.
- **Single-core saturation**: no parallelism.
### 매 Fix Strategy
1. **Profile first** — 매 measure, not guess.
2. **Off-main-thread**: WebWorker, OffscreenCanvas.
3. **Batch**: requestAnimationFrame, microtask.
4. **SIMD/WASM**: 매 hot inner loop.
5. **Algorithmic**: O(n²) → O(n log n).
6. **Cache**: memoize, weak-ref.
7. **Lazy**: defer, code-split.
## 💻 패턴
### Detect long task
```javascript
const obs = new PerformanceObserver(list => {
for (const e of list.getEntries()) {
if (e.duration > 50) console.warn('long task', e.duration, e.name);
}
});
obs.observe({ entryTypes: ['longtask'] });
```
### Move work to Worker
```javascript
// main.js
const w = new Worker('worker.js', { type: 'module' });
w.postMessage({ data: bigArray }, [bigArray.buffer]); // 매 transfer, zero-copy
w.onmessage = e => render(e.data);
// worker.js
self.onmessage = e => {
const result = heavyCompute(e.data.data);
self.postMessage(result, [result.buffer]);
};
```
### WASM SIMD hot loop (Rust)
```rust
#[target_feature(enable = "simd128")]
unsafe fn dot_product(a: &[f32], b: &[f32]) -> f32 {
use std::arch::wasm32::*;
let mut sum = f32x4_splat(0.0);
for i in (0..a.len()).step_by(4) {
let va = v128_load(a.as_ptr().add(i) as *const v128);
let vb = v128_load(b.as_ptr().add(i) as *const v128);
sum = f32x4_add(sum, f32x4_mul(va, vb));
}
f32x4_extract_lane::<0>(sum) + f32x4_extract_lane::<1>(sum)
+ f32x4_extract_lane::<2>(sum) + f32x4_extract_lane::<3>(sum)
}
```
### Time-sliced loop (yield to event loop)
```javascript
async function processChunked(items) {
const CHUNK = 200;
for (let i = 0; i < items.length; i += CHUNK) {
items.slice(i, i + CHUNK).forEach(processOne);
await new Promise(r => setTimeout(r, 0)); // 매 yield
}
}
// 또는 scheduler.yield() (2025+)
if ('scheduler' in window && 'yield' in scheduler) await scheduler.yield();
```
### Batch DOM read/write
```javascript
// 매 안티 — layout thrash
items.forEach(el => { const w = el.offsetWidth; el.style.width = (w*2)+'px'; });
// 매 fix — read first, then write
const widths = items.map(el => el.offsetWidth);
items.forEach((el, i) => { el.style.width = (widths[i]*2)+'px'; });
```
### Linux perf hot function
```bash
sudo perf record -F 99 -g -p $(pidof myapp) -- sleep 10
sudo perf report --stdio | head -40
sudo perf script | stackcollapse-perf.pl | flamegraph.pl > flame.svg
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Long JS function | WebWorker / time-slice |
| Image/video pipeline | OffscreenCanvas |
| Number crunching | WASM SIMD / GPU compute |
| Layout thrash | read-then-write batch |
| GC pressure | object pool |
| Multi-core unused | Worker pool / parallel |
**기본값**: 매 measure → identify hot fn → off-main-thread or algorithmic fix.
## 🔗 Graph
- 부모: [[Analyze runtime performance]] · [[Flame_Graphs]]
- 변형: [[Draw Call]]
- 응용: [[Tree Shaking (번들 크기 최적화)]] · [[Frustum Culling]]
- Adjacent: [[Memory Management]] · [[Branch Prediction]]
## 🤖 LLM 활용
**언제**: profile flamegraph 해석, hot-function refactor 제안, perf annotation.
**언제 X**: 매 actual perf measurement — deterministic 도구가 정확.
## ❌ 안티패턴
- **Premature optimization**: 매 profile 없이 추측 — 잘못된 부분 fix.
- **Worker overuse**: 매 small task 의 postMessage 오버헤드 > 이득.
- **`while(true)` busy-wait**: 매 throttle / requestIdleCallback 사용.
- **Synchronous XHR**: 매 deprecated, main-thread block.
## 🧪 검증 / 중복
- Verified: Chrome Performance docs; web.dev Long Tasks; Linux perf-tools (Brendan Gregg).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — diagnosis + Worker/SIMD/yield patterns |
@@ -0,0 +1,151 @@
---
id: wiki-2026-0508-cheneys-algorithm
title: Cheney's Algorithm
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Cheney GC, Semi-space Collector, Copying GC]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [gc, memory, algorithm, runtime]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C/Rust
framework: runtime/GC
---
# Cheney's Algorithm
## 매 한 줄
> **"매 stop-and-copy GC 의 BFS-style two-finger traversal"**. 1970년 C.J. Cheney 가 제시한 copying garbage collector 의 표준 algorithm — recursion 없이 queue-style 로 live object 를 from-space 에서 to-space 로 evacuate. 매 modern V8/SpiderMonkey young generation, OCaml minor heap, MLton 의 baseline.
## 매 핵심
### 매 semi-space 구조
- Heap 을 두 개의 equal-sized region 으로 split: from-space, to-space.
- Allocation 은 from-space 의 bump pointer 만 증가.
- GC 시 live object 를 to-space 로 copy 후 role swap.
### 매 two pointers
- `scan`: to-space 에서 아직 children 추적 안 한 boundary.
- `free`: to-space 의 next allocation slot.
- `scan == free` 이면 traversal 종료.
### 매 응용
1. V8 young-gen scavenger (Node.js, Chrome).
2. OCaml minor heap collection.
3. SBCL, MLton 의 default GC.
## 💻 패턴
### Core Cheney loop (C)
```c
void* to_space; size_t scan, free_;
void* copy(void* obj) {
if (is_forwarded(obj)) return forward_addr(obj);
size_t sz = size_of(obj);
void* dst = (char*)to_space + free_;
memcpy(dst, obj, sz);
set_forward(obj, dst);
free_ += sz;
return dst;
}
void cheney_gc(void** roots, size_t n) {
free_ = scan = 0;
for (size_t i = 0; i < n; i++) roots[i] = copy(roots[i]);
while (scan < free_) {
void* obj = (char*)to_space + scan;
for_each_pointer_field(obj, p) { *p = copy(*p); }
scan += size_of(obj);
}
swap(from_space, to_space);
}
```
### Forwarding pointer trick
```c
// Object header overlap: live header OR forwarding pointer.
struct header { uintptr_t tag_or_fwd; };
#define IS_FWD(h) ((h)->tag_or_fwd & 1)
#define FWD_PTR(h) ((void*)((h)->tag_or_fwd & ~1))
#define SET_FWD(h, dst) ((h)->tag_or_fwd = (uintptr_t)(dst) | 1)
```
### Allocation (post-GC)
```c
void* alloc(size_t sz) {
if (free_ + sz > SEMI_SIZE) cheney_gc(roots, n_roots);
if (free_ + sz > SEMI_SIZE) abort(); // OOM
void* p = (char*)to_space + free_;
free_ += sz;
return p;
}
```
### V8-style scavenger (simplified)
```cpp
void Scavenger::Process() {
while (!worklist_.empty()) {
HeapObject obj = worklist_.Pop();
obj->IterateBody(this); // visits each pointer field
}
}
void Scavenger::VisitPointer(Object** slot) {
HeapObject obj = HeapObject::cast(*slot);
if (Heap::InFromSpace(obj)) {
HeapObject target = EvacuateObject(obj);
*slot = target;
}
}
```
### Generational tweak
```c
// Young gen uses Cheney; old gen uses mark-sweep.
// Promotion: if object survives N scavenges, copy to old-gen instead of to-space.
if (age(obj) >= PROMOTION_THRESHOLD) dst = old_gen_alloc(sz);
else dst = (char*)to_space + free_;
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Short-lived allocation 多 | Cheney (semi-space) — fast bump alloc |
| Large heap, low live ratio | Cheney 우수 (cost ∝ live, not heap) |
| Mostly-live mature data | Mark-sweep / mark-compact |
| Real-time constraints | Incremental / concurrent GC (Shenandoah, ZGC) |
| Memory tight (mobile) | Mark-sweep (no 2× overhead) |
**기본값**: Young generation 에 Cheney, old generation 에 mark-compact (generational hypothesis).
## 🔗 Graph
- 부모: [[Garbage Collection]] · [[Memory Management]]
- 변형: [[Mark-Sweep]]
- 응용: [[V8 Engine]] · [[Nodejs]]
- Adjacent: [[Write Barrier]]
## 🤖 LLM 활용
**언제**: GC 설명, runtime internals 분석, language implementation 설계 시.
**언제 X**: Application-level memory tuning (use language-specific profiler 대신).
## ❌ 안티패턴
- **Naive recursive copy**: stack overflow 가능 — Cheney 의 queue 방식 사용.
- **Forgetting forward check**: 동일 object 두 번 copy → 데이터 corrupt.
- **Pointer 누락**: stack/register/global root scan 빠짐 → dangling pointer.
- **Pinning ignored**: native pointer 가 from-space object 가리키는 동안 GC → crash.
## 🧪 검증 / 중복
- Verified (Cheney 1970 CACM paper, V8/SpiderMonkey source).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Cheney GC algorithm 의 BFS copy + V8 scavenger 패턴 |
@@ -0,0 +1,164 @@
---
id: wiki-2026-0508-chrome-v8-heap-analysis
title: Chrome V8 Heap Analysis
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [V8 Heap Snapshot, Chrome DevTools Memory, Heap Profiler]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [v8, chrome, heap, debugging, performance]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: javascript
framework: chrome-devtools
---
# Chrome V8 Heap Analysis
## 매 한 줄
> **"매 heap snapshot 의 retain path"**. 매 V8 의 mark-sweep + generational GC 의 internal state 의 DevTools Memory tab 을 통한 introspection 의 production 의 leak 의 root cause 의 identification 의 enable. 매 2026 년 의 Chrome 132+ 의 trace-based + sampling allocator 의 < 5% overhead 의 production profiling 의 standard.
## 매 핵심
### 매 Snapshot 종류
- **Heap snapshot**: 매 모든 reachable object 의 graph 의 capture. 매 retainers 의 trace.
- **Allocation timeline**: 매 시간 에 따라 allocate 된 object 의 추적. 매 churn 의 detection.
- **Allocation sampling**: 매 lightweight (5% 이하 overhead). 매 production 의 OK.
### 매 V8 GC structure
- **Young generation (Scavenger)**: 매 fast minor GC. 매 semi-space copying.
- **Old generation (Mark-Sweep-Compact)**: 매 incremental mark + concurrent sweep.
- **Code space, Map space, Large object space**: 매 separate region.
### 매 응용
1. Memory leak hunt — DOM detached node 의 detection.
2. Bundle size 의 runtime impact analysis.
3. Closure-induced retention 의 audit.
4. Listener leak 의 trace.
## 💻 패턴
### Programmatic snapshot (Node.js / Electron)
```javascript
const v8 = require('v8');
const fs = require('fs');
function takeHeapSnapshot(label) {
const path = `./heap-${label}-${Date.now()}.heapsnapshot`;
const stream = v8.getHeapSnapshot();
stream.pipe(fs.createWriteStream(path));
return path;
}
// Usage: take 3 snapshots, compare in DevTools
takeHeapSnapshot('baseline');
runWorkload();
global.gc?.();
takeHeapSnapshot('after-gc');
```
### Detached DOM detection
```javascript
// In Console / Snapshot Comparison view
// Filter by "Detached HTMLDivElement"
// → retainer chain shows the closure / array holding it
class LeakyComponent {
constructor() {
this.handlers = [];
document.addEventListener('scroll', this.onScroll); // leak: never removed
}
onScroll = () => { /* ... */ }
}
// Fix: store bound ref, removeEventListener in destroy()
```
### CDP (Chrome DevTools Protocol) automation
```javascript
const CDP = require('chrome-remote-interface');
async function profileHeap() {
const client = await CDP();
const { HeapProfiler } = client;
await HeapProfiler.enable();
await HeapProfiler.collectGarbage();
const chunks = [];
HeapProfiler.on('addHeapSnapshotChunk', ({ chunk }) => chunks.push(chunk));
await HeapProfiler.takeHeapSnapshot({ reportProgress: false });
return chunks.join('');
}
```
### Sampling allocation profiler
```javascript
// V8 11+, ~512KB sample interval
const profiler = require('v8-profiler-next');
profiler.startSamplingHeapProfiler(512 * 1024, 64);
// ... workload ...
const profile = profiler.stopSamplingHeapProfiler();
fs.writeFileSync('alloc.heapprofile', JSON.stringify(profile));
```
### --inspect + automated diff
```bash
node --inspect=0.0.0.0:9229 server.js
# Connect Chrome DevTools → Memory → take snapshot
# Run load test → take 2nd snapshot
# Comparison view → filter "Delta > 0" + sort by Retained Size
```
### Constructor filter (find specific class instances)
```javascript
// In DevTools heap viewer
// class: SomeBigBuffer → see all live instances + retainers
// Common pattern: a Map / Set holding stale references
```
### --max-old-space-size tuning
```bash
node --max-old-space-size=4096 --expose-gc app.js
# or for Chrome:
chrome --js-flags="--max-old-space-size=8192"
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Production leak (live) | Sampling allocation profiler (low overhead) |
| Dev / staging deep dive | Full heap snapshot diff (3-snapshot technique) |
| Allocation hotspot | Allocation timeline |
| Specific class instances | Constructor filter |
| CI regression check | Programmatic `v8.getHeapSnapshot()` + threshold |
**기본값**: 매 3-snapshot technique (baseline → workload → after-gc → diff).
## 🔗 Graph
- 부모: [[V8 Engine]] · [[Chrome DevTools Memory Profiling|Chrome DevTools]]
- 변형: [[Electron V8 Memory Cage]]
- 응용: [[Memory Leak Detection]] · [[Performance Optimization]]
- Adjacent: [[Garbage Collection]]
## 🤖 LLM 활용
**언제**: 매 leak 의 reproducibility 의 OK 의 case. 매 retainer chain 의 interpretation 의 LLM 의 강점.
**언제 X**: 매 production 의 large heap (> 4GB) 의 snapshot 의 capture 의 비용 (multi-second pause).
## ❌ 안티패턴
- **Snapshot before GC X**: 매 항상 `--expose-gc` + `global.gc()` 후 snapshot. 매 noise 의 reduction.
- **Single snapshot 의존**: 매 항상 diff. 매 absolute size 의 less informative.
- **Closures의 underestimate**: 매 arrow function 의 lexical scope 의 모든 outer var 의 retain.
## 🧪 검증 / 중복
- Verified (V8 docs, Chrome DevTools docs, Node.js v8 module).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — V8 heap snapshot / leak hunting workflow |
@@ -0,0 +1,157 @@
---
id: wiki-2026-0508-code-obfuscation
title: Code Obfuscation
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Obfuscation, Anti-Reverse Engineering]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, reverse-engineering, drm, javascript]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: JavaScript/C++
framework: obfuscator.io/LLVM-Obfuscator
---
# Code Obfuscation
## 매 한 줄
> **"매 reverse-engineering cost 의 raise — semantic 보존하면서 readability 파괴"**. Crypto 처럼 secrecy 가 아닌 cost-shifting — determined attacker 는 매 결국 풀 수 있음. 매 modern usage: anti-piracy, anti-cheating, license validation, 매 LLM-based deobfuscation 의 등장으로 의미 retreat.
## 매 핵심
### 매 layer
- **Lexical**: rename identifier (`x_a1b2c3`).
- **Control flow**: opaque predicate, control-flow flattening.
- **Data**: string encryption, constant unfolding.
- **Anti-analysis**: anti-debug, VM detection, integrity check.
- **Virtualization**: custom VM bytecode (VMProtect, Themida).
### 매 trade-off
- Performance: 2-10× slowdown (virtualization 시).
- Size: 2-5× binary bloat.
- Stability: false positive 가능 (anti-debug).
- Security: 매 cost-raise 만 — break 시간을 hours → weeks 로.
### 매 응용
1. JavaScript bundle (anti-scraping).
2. Mobile app DRM, license check.
3. Game anti-cheat (e.g., VAC, EAC).
4. Malware (defensive obfuscation).
## 💻 패턴
### String encryption
```javascript
// Before
const KEY = "secret-api-key";
// After
const _0xa1b2 = ['c2VjcmV0', 'LWFwaQ==', 'LWtleQ=='];
const _0xc3d4 = (i) => atob(_0xa1b2[i]);
const KEY = _0xc3d4(0) + _0xc3d4(1) + _0xc3d4(2);
```
### Control-flow flattening
```c
// Before: linear flow
void f() { a(); b(); c(); }
// After: dispatcher loop
void f_obf() {
int state = 0;
while (state != -1) {
switch (state) {
case 0: a(); state = 7; break;
case 7: b(); state = 3; break;
case 3: c(); state = -1; break;
}
}
}
```
### Opaque predicate
```cpp
// Always true at runtime, hard to determine statically
auto opaque = [](int x) { return (x*x*x - x) % 3 == 0; }; // always true for any int
if (opaque(rand())) real_logic();
else fake_branch(); // dead but appears live to disassembler
```
### Identifier mangling (terser)
```javascript
// terser config
{
mangle: {
toplevel: true,
properties: { regex: /^_/ }
},
compress: { passes: 3, dead_code: true }
}
```
### Anti-debug (browser)
```javascript
setInterval(() => {
const t = performance.now();
debugger; // pauses if devtools open
if (performance.now() - t > 100) {
// devtools detected
location.href = 'about:blank';
}
}, 1000);
```
### LLVM IR pass (obfuscator-llvm style)
```cpp
struct StringObfPass : PassInfoMixin<StringObfPass> {
PreservedAnalyses run(Module &M, ModuleAnalysisManager&) {
for (auto &GV : M.globals()) {
if (auto *CDA = dyn_cast<ConstantDataArray>(GV.getInitializer())) {
if (CDA->isString()) xor_encrypt(GV);
}
}
return PreservedAnalyses::none();
}
};
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Web bundle anti-scraping | terser + javascript-obfuscator |
| Native binary (commercial) | VMProtect / Themida |
| Open-source w/ embedded secret | DON'T — use server-side proxy |
| Game anti-cheat | Kernel driver + virtualization |
| Mobile DRM | Hardware-backed (TEE, SEP) — obfuscation 보조 |
**기본값**: Don't obfuscate — secrets belong server-side. Necessary 시 매 layered defense.
## 🔗 Graph
- 응용: [[Malware Analysis]]
## 🤖 LLM 활용
**언제**: Defense-in-depth context, malware analysis 학습, anti-tamper design.
**언제 X**: Hiding actual secrets — broken by definition. 매 server-side 가 답.
## ❌ 안티패턴
- **Security through obscurity (alone)**: 매 always falls.
- **Embedding API key in client**: obfuscation 으로도 매 보호 불가.
- **Custom crypto**: roll-your-own → obfuscation 보다 매 weaker.
- **Performance ignored**: 10× slowdown 으로 UX 망침.
- **No update path**: 매 break 되면 매 fresh release 필요 — automation 필수.
## 🧪 검증 / 중복
- Verified (Collberg taxonomy, obfuscator-llvm, javascript-obfuscator).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — obfuscation taxonomy + JS/LLVM patterns |
@@ -0,0 +1,147 @@
---
id: wiki-2026-0508-code-stylometry-코드-문체론
title: Code Stylometry (코드 문체론)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Authorship Attribution, Code Fingerprinting, Programmer Identification]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, ml, forensics, privacy]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Python
framework: scikit-learn/transformers
---
# Code Stylometry (코드 문체론)
## 매 한 줄
> **"매 코드 작성자를 매 stylistic feature 로 식별하는 ML 기법"**. Caliskan et al. 2015 (USENIX) 가 random forest 로 250 명 중 94% 식별. 매 modern era — CodeBERT/StarCoder embedding 기반 분류기로 매 더 강력해짐. Privacy 위협 (anonymous contributor de-anon) ↔ defensive utility (malware attribution, plagiarism detection) 의 양날.
## 매 핵심
### 매 feature class
- **Lexical**: identifier naming (camelCase vs snake_case), keyword frequency.
- **Layout**: indentation, brace style, line length.
- **Syntactic**: AST node distribution, depth, n-gram of node types.
- **Idiomatic**: preferred construct (`for` vs `map`, ternary vs if).
- **Embedding-based**: CodeBERT/StarCoder hidden states (2024+).
### 매 attack scenario
- De-anonymizing GitHub anonymous account.
- Linking malware author across samples.
- Plagiarism detection in coursework.
- Insider threat attribution.
### 매 응용
1. Forensic attribution (FBI/Interpol cases).
2. Academic integrity (MOSS, JPlag).
3. Bug-injection-source detection (xz-style supply chain).
## 💻 패턴
### Layout features
```python
import re
def layout_features(src: str) -> dict:
lines = src.split('\n')
return {
'avg_line_len': sum(len(l) for l in lines) / max(len(lines), 1),
'tab_ratio': sum(l.startswith('\t') for l in lines) / max(len(lines), 1),
'blank_ratio': sum(not l.strip() for l in lines) / max(len(lines), 1),
'snake_ratio': len(re.findall(r'\b[a-z]+_[a-z]+\b', src)),
'camel_ratio': len(re.findall(r'\b[a-z]+[A-Z][a-z]+\b', src)),
}
```
### AST n-gram (Python)
```python
import ast
from collections import Counter
def ast_ngrams(src: str, n=3):
tree = ast.parse(src)
seq = [type(node).__name__ for node in ast.walk(tree)]
return Counter(tuple(seq[i:i+n]) for i in range(len(seq)-n+1))
```
### Random forest classifier (Caliskan-style)
```python
from sklearn.ensemble import RandomForestClassifier
from sklearn.feature_extraction import DictVectorizer
vec = DictVectorizer(sparse=False)
X = vec.fit_transform([extract_all_features(s) for s in samples])
clf = RandomForestClassifier(n_estimators=300, max_depth=20)
clf.fit(X, authors)
print(clf.score(X_test, y_test)) # ~90%+ on 100-author corpus
```
### CodeBERT embedding classifier (2024+)
```python
from transformers import AutoTokenizer, AutoModel
import torch
tok = AutoTokenizer.from_pretrained('microsoft/codebert-base')
model = AutoModel.from_pretrained('microsoft/codebert-base').eval()
def embed(src: str) -> torch.Tensor:
inp = tok(src, truncation=True, max_length=512, return_tensors='pt')
with torch.no_grad():
out = model(**inp).last_hidden_state[:, 0] # CLS
return out.squeeze()
# Then train linear classifier on embeddings
```
### Defensive: code anonymizer
```python
# Normalize to defeat stylometry
import black, autopep8
def anonymize(src: str) -> str:
src = black.format_str(src, mode=black.Mode()) # uniform layout
# rename identifiers via AST transform
# replace idiosyncratic constructs with canonical form
return src
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Small corpus (<50 authors) | RF on hand-crafted features |
| Large corpus, deep features | CodeBERT/StarCoder embedding + classifier |
| Defending privacy | Black/Prettier + identifier normalization |
| Adversarial robust attack | Limited — formatting tools 매 defeat 대부분 |
| Cross-language | Embedding-based 만 가능 |
**기본값**: 매 RF + AST n-gram 으로 baseline. Embedding 으로 boost.
## 🔗 Graph
- 부모: [[Authorship Attribution]]
- 응용: [[Supply Chain Security]]
- Adjacent: [[Code Obfuscation]] · [[AST]]
## 🤖 LLM 활용
**언제**: Forensic context, plagiarism check, OSS contributor analysis.
**언제 X**: Identifying anonymous whistleblower — ethical 매 거부.
## ❌ 안티패턴
- **Single-feature reliance**: layout 만 → autoformatter 로 매 trivial defeat.
- **Ignoring base rate**: low base rate = high false positive rate (Bonferroni).
- **Author-set assumption**: open-world (unknown author) ≠ closed-world.
- **Privacy ignored**: deploying on anonymous code 매 ethical review 없이.
## 🧪 검증 / 중복
- Verified (Caliskan USENIX 2015, Abuhamad 2018, CodeBERT papers).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — stylometry features + RF/CodeBERT pipelines |
@@ -0,0 +1,157 @@
---
id: wiki-2026-0508-code-property-graph
title: Code Property Graph
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [CPG, Code Property Graphs, Joern CPG]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, sast, cpg, static-analysis]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: scala
framework: joern
---
# Code Property Graph
## 매 한 줄
> **"매 CPG 의 의미: 매 AST + CFG + PDG 의 매 single graph representation"**. 매 Yamaguchi et al. (2014) 가 매 IEEE S&P 의 매 propose, 매 Joern 의 매 implement. 매 2026 modern SAST (Joern, Qwiet AI/ShiftLeft, CodeQL의 dataflow) 의 매 backbone.
## 매 핵심
### 매 3 layer
- **AST** (Abstract Syntax Tree): 매 syntactic structure
- **CFG** (Control Flow Graph): 매 execution order, branches
- **PDG** (Program Dependency Graph): 매 data + control dependencies
### 매 single graph
- 매 node = AST node
- 매 edge = AST parent / CFG next / PDG dataflow / call edge
- 매 query 의 graph traversal 로 매 vulnerability pattern 감지
### 매 query language
- **Joern**: Scala-based DSL (Gremlin-like)
- **CodeQL**: declarative QL language (similar concept)
- **Semgrep**: 매 simpler (AST-only), 매 not full CPG
### 매 응용
1. 매 SAST: 매 SQLi/XSS/RCE pattern 의 매 detection.
2. 매 audit: 매 sensitive sink (exec, eval) 의 매 tainted source 까지 trace.
3. 매 academic research: 매 vulnerability mining (CVE 의 retroactive find).
## 💻 패턴
### Joern 의 매 install + import
```bash
# 2026 Joern v4
curl -L https://github.com/joernio/joern/releases/latest/download/joern-install.sh | sh
joern --import src/
joern> importCode("path/to/project")
joern> cpg.method.l
```
### 매 SQLi pattern detection
```scala
// Joern Scala query: 매 user input 의 SQL 실행 까지 도달
cpg.method.name("query|execute")
.parameter
.reachableBy(cpg.method.name("getParameter|req\\.body").ast)
.l
```
### 매 hardcoded secret detection
```scala
cpg.literal
.code("\"[A-Za-z0-9+/]{32,}\"")
.filter(_.method.name != "test")
.l
```
### CodeQL 의 매 taint tracking (similar)
```ql
import javascript
class Configuration extends TaintTracking::Configuration {
Configuration() { this = "UserInputToEval" }
override predicate isSource(DataFlow::Node source) {
source instanceof RemoteFlowSource
}
override predicate isSink(DataFlow::Node sink) {
exists(CallExpr c | c.getCalleeName() = "eval" |
sink.asExpr() = c.getArgument(0))
}
}
from Configuration cfg, DataFlow::PathNode source, DataFlow::PathNode sink
where cfg.hasFlowPath(source, sink)
select sink, source, sink, "Tainted eval"
```
### 매 custom 매 sink 정의
```scala
val customSinks = cpg.call.name("dangerouslySetInnerHTML|innerHTML")
val customSources = cpg.call.name("fetch|axios.get").argument(1)
customSinks.reachableBy(customSources).l
```
### 매 CPG 의 매 export (for visualization)
```scala
joern> cpg.runScript("export-cpg.sc")
// 매 GraphML / DOT / Neo4j 로 export
```
### 매 CI integration (Joern Scan)
```yaml
# .github/workflows/joern.yml
- name: Joern Scan
run: |
joern-scan --src ./src --output joern-report.json
jq '.findings[] | select(.severity=="HIGH")' joern-report.json
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Quick rule-based scan | 매 Semgrep (syntactic, fast) |
| Deep dataflow analysis | 매 Joern / CodeQL (CPG-based) |
| GitHub-native | 매 CodeQL (Advanced Security) |
| Multi-language audit | 매 Joern (C/C++/Java/Python/JS/PHP) |
| Custom vuln mining | 매 Joern Scala script |
**기본값**: 매 Semgrep (매 quick CI gate) + 매 CodeQL (매 deep weekly audit).
## 🔗 Graph
- 부모: [[SAST]] · [[Static Analysis]]
- 변형: [[AST]]
- 응용: [[Joern]] · [[CodeQL]]
- Adjacent: [[보안 및 시스템 신뢰성 표준|DAST]] · [[SCA_Fundamentals|SCA]] · [[DevSecOps Framework]]
## 🤖 LLM 활용
**언제**: 매 Joern Scala query 의 draft, 매 CPG result 의 false positive triage, 매 custom sink/source 의 suggestion.
**언제 X**: 매 LLM 의 self 의 vulnerability detection — 매 hallucination risk. 매 CPG-based 결과 가 매 ground truth.
## ❌ 안티패턴
- **CPG 의 build 만 하고 의 query 의 X**: 매 graph 의 사용 안함.
- **매 source / sink 의 매 default 만**: 매 framework-specific (Express, Spring) 의 매 manual 정의 필요.
- **매 Joern 의 huge codebase 의 timeout**: 매 incremental import / 매 module 별 split.
- **매 alert fatigue**: 매 severity tuning 없이 매 모든 finding raise.
## 🧪 검증 / 중복
- Verified (Yamaguchi et al. 2014 IEEE S&P; Joern docs; CodeQL docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — CPG full content |
@@ -0,0 +1,146 @@
---
id: wiki-2026-0508-cognitive-load
title: Cognitive Load
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Mental Load, Working Memory Pressure, Code Complexity Tax]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [engineering, design, code-quality, devex]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: any
framework: software-engineering
---
# Cognitive Load
## 매 한 줄
> **"매 working memory 에 동시에 매 잡고 있어야 하는 정보의 양"**. Sweller 의 cognitive load theory (1988) 에 기반 — intrinsic, extraneous, germane 의 3-tier. 매 modern software design 의 first-principle metric — 작은 cognitive load 가 매 maintainable code 를 결정.
## 매 핵심
### 매 3 종류
- **Intrinsic**: 문제 자체의 본질적 복잡도 (e.g., distributed consensus).
- **Extraneous**: 표현/도구 가 만드는 인위적 복잡도 (bad naming, deep nesting).
- **Germane**: schema 형성 과정 (learning) — useful load.
### 매 7±2 rule
- Working memory 는 약 4-7 chunk 만 동시 처리 (Miller 1956, refined Cowan 2001).
- Code 가 이 한계 넘으면 → bug, slow review, onboarding 지연.
### 매 응용
1. Function 의 line / parameter 제한 (small functions).
2. Module boundary 설계 — high cohesion, low coupling.
3. PR size 제한 (200-400 line max).
4. Naming convention — domain language 사용.
## 💻 패턴
### Guard clause 로 nesting 줄임
```python
# BAD: deep nesting (high extraneous load)
def process(user):
if user is not None:
if user.is_active:
if user.has_permission('write'):
return do_work(user)
return None
# GOOD: early return
def process(user):
if user is None: return None
if not user.is_active: return None
if not user.has_permission('write'): return None
return do_work(user)
```
### Extract domain primitive
```typescript
// BAD: primitive obsession — caller must remember semantics
function transfer(from: string, to: string, amount: number, currency: string) {}
// GOOD: types carry semantics
type AccountId = string & { __brand: 'AccountId' };
type Money = { amount: bigint; currency: Currency };
function transfer(from: AccountId, to: AccountId, money: Money) {}
```
### 매 colocation
```tsx
// BAD: scattered — must context-switch
// styles.css, validation.ts, component.tsx, types.ts
// GOOD: single-file feature unit (Astro/Svelte/RSC era)
export function Form() {
const validate = (v: string) => v.length > 0;
return <input onBlur={e => validate(e.target.value)} />;
}
```
### Boundary objects
```python
# Each layer translates — caller doesn't need to know inner schema
class UserDTO: # external API shape
...
class User: # domain entity
...
class UserRow: # DB schema
...
def to_domain(dto: UserDTO) -> User: ...
def to_row(user: User) -> UserRow: ...
```
### Team Topologies pattern
```yaml
# Stream-aligned team owns a single bounded context
# Platform team provides self-service infra
# Goal: each team's cognitive load fits one team's working memory
team: payments
owns: [PaymentService, RefundService, payment-db]
depends_on:
platform: [k8s-cluster, observability]
enabling: []
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Function > 50 lines | Extract sub-functions or strategy |
| Class > 7 public methods | Split by responsibility |
| Team owns > 1 product area | Reorg per Team Topologies |
| Domain logic mixed w/ infra | Hexagonal / Clean Architecture |
| Onboarding > 2 weeks | Reduce coupling, write decision records |
**기본값**: Optimize for reader, not writer — 매 reduce extraneous, accept intrinsic.
## 🔗 Graph
- 부모: [[Cognitive Psychology]]
- 응용: [[Team Topologies]] · [[Hexagonal Architecture]] · [[Clean Code]]
- Adjacent: [[Working Memory]] · [[Code Smell]]
## 🤖 LLM 활용
**언제**: Code review, refactoring decision, team structure 설계, PR size 판단.
**언제 X**: Pure performance optimization (different metric).
## ❌ 안티패턴
- **Cleverness 자랑**: dense one-liner, clever bitwise — high extraneous.
- **God object**: 30+ method class — exceeds chunking capacity.
- **Magic constants**: `if x > 86400` 대신 `SECONDS_PER_DAY`.
- **Implicit context**: global mutable state — reader 가 매 trace 해야 함.
- **Premature abstraction**: framework-itis — abstraction 이 intrinsic 아닌데 추가됨.
## 🧪 검증 / 중복
- Verified (Sweller 1988, Skelton & Pais 2019 Team Topologies).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — cognitive load theory + practical refactoring patterns |
@@ -0,0 +1,143 @@
---
id: wiki-2026-0508-commit-history
title: Commit History
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Git Log, Commit Log, Git History]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [git, vcs, history]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Bash
framework: Git
---
# Commit History
## 매 한 줄
> **"매 commit 은 미래의 자기 자신을 위한 편지다."**. Commit history 는 매 codebase 의 시간축 — bisect, blame, revert, audit 의 매 기반. 2026 의 표준은 Conventional Commits + signed commits (Sigstore gitsign / SSH key) + linear history (rebase or squash-merge).
## 매 핵심
### 매 좋은 history 의 특징
- **Atomic**: 매 한 commit = 한 logical change.
- **Descriptive subject**: 50자, imperative — "Fix login race".
- **Body explains why**: 매 what 은 diff 가 보여줌 — why 가 commit 의 가치.
- **Linkable**: issue/PR ref.
- **Signed**: GPG / SSH / gitsign — supply-chain integrity.
- **Linear or trunked**: bisect 친화적.
### 매 Conventional Commits
```
<type>(<scope>): <subject>
<body>
<footer>
```
- type: feat, fix, refactor, perf, test, docs, chore, build, ci.
- 매 BREAKING CHANGE: footer.
### 매 응용
1. Bisect — 매 regression commit 이분 탐색.
2. Blame — 매 line author/intent 추적.
3. Cherry-pick — hotfix backport.
4. Revert — production rollback.
5. Changelog — automated (release-please, semantic-release).
6. Audit — compliance, post-mortem.
## 💻 패턴
### git bisect 자동화
```bash
git bisect start
git bisect bad HEAD
git bisect good v1.2.0
git bisect run npm test # 매 each step automated
git bisect reset
```
### Signed commit (gitsign / Sigstore)
```bash
# 매 keyless OIDC sign
git config --global gpg.x509.program gitsign
git config --global gpg.format x509
git config --global commit.gpgsign true
git commit -m "feat: signed via gitsign"
git verify-commit HEAD
```
### Conventional Commits + commitlint
```js
// commitlint.config.js
export default {
extends: ['@commitlint/config-conventional'],
rules: { 'subject-max-length': [2, 'always', 72] },
};
```
### Interactive rebase cleanup (before push)
```bash
git rebase -i origin/main # 매 squash, reword, reorder
```
### git log advanced query
```bash
# 매 작가별 last week
git log --since='1 week ago' --pretty=format:'%h %an %s'
# 매 specific file 의 changes (move 추적)
git log --follow -p src/auth.ts
# 매 grep in patches
git log -G 'eval\(' --oneline
```
### release-please automation
```yaml
- uses: googleapis/release-please-action@v4
with: { release-type: node }
# 매 Conventional Commits → CHANGELOG.md + version bump PR
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Feature branch | rebase + squash-merge |
| Long-running branch | merge commit (주의) |
| Hotfix | cherry-pick to release |
| Breaking change | BREAKING CHANGE footer + major bump |
| Compliance | signed commits + protected branch |
**기본값**: 매 Conventional Commits + signed + squash-merge.
## 🔗 Graph
- 부모: [[Source-Control]] · [[Version_Control_Systems]]
- 변형: [[버전_관리_시스템_VCS]]
- 응용: [[CI_CD_Pipeline]] · [[Husky]]
- Adjacent: [[Code_Property_Graph]]
## 🤖 LLM 활용
**언제**: commit message 생성, PR description, changelog draft, post-mortem timeline 정리.
**언제 X**: 매 actual git operations — automation 이 deterministic.
## ❌ 안티패턴
- **"WIP" commit**: 매 squash 전 cleanup.
- **거대 commit**: 매 review 불가 — split.
- **Force-push to shared branch**: 매 history rewrite, others lose work.
- **Unsigned in regulated**: 매 SOC2/SLSA 위반.
- **`git add .` blindly**: 매 secret 유출 위험.
## 🧪 검증 / 중복
- Verified: Conventional Commits 1.0; Sigstore gitsign docs; Git docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Conventional Commits + signing + bisect |
@@ -0,0 +1,152 @@
---
id: wiki-2026-0508-concrete-syntax-tree-cst
title: Concrete Syntax Tree (CST)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Parse Tree, CST, Lossless Syntax Tree]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [parser, ast, tooling, language-engineering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Rust/JS
framework: tree-sitter/rowan
---
# Concrete Syntax Tree (CST)
## 매 한 줄
> **"매 source 의 every token (whitespace, comment 포함) 까지 보존하는 lossless tree"**. AST 가 semantic-only 인 반면 CST 는 매 source 의 round-trip 가능. 매 modern tooling — tree-sitter, rowan (rust-analyzer), Roslyn — 매 CST 위에서 매 IDE feature, refactoring, formatter 를 매 build.
## 매 핵심
### 매 vs AST
- **AST**: semantic node 만 (`if`, `BinaryOp`, etc) — comment, whitespace 버림.
- **CST**: 모든 token + trivia 보존 — `source == reprint(cst)`.
- CST → AST 의 lowering 가능, 역은 매 lossy.
### 매 핵심 properties
- **Lossless**: print 시 원본 byte-for-byte 복구.
- **Error-tolerant**: incomplete/invalid code 도 partial tree.
- **Incremental**: edit 시 affected subtree 만 reparse (tree-sitter).
- **Untyped or weakly-typed**: 모든 node 가 동질 — typed wrapper 로 navigate.
### 매 응용
1. IDE: syntax highlight, fold, outline, indent.
2. Refactoring: rename, extract method (preserve formatting).
3. Formatter: prettier, rustfmt — CST 로 layout 결정.
4. Linter: tree-sitter queries.
## 💻 패턴
### tree-sitter parsing
```javascript
const Parser = require('tree-sitter');
const TS = require('tree-sitter-typescript').typescript;
const parser = new Parser();
parser.setLanguage(TS);
const tree = parser.parse('const x: number = 1;');
// Walk
const cursor = tree.walk();
do { console.log(cursor.nodeType, cursor.startIndex, cursor.endIndex); }
while (cursor.gotoNextSibling() || cursor.gotoFirstChild());
```
### tree-sitter query (S-expression)
```scheme
; Find all function declarations
(function_declaration
name: (identifier) @func.name
parameters: (formal_parameters) @func.params)
; Find unused imports
(import_statement
source: (string) @import.source) @import
```
### Incremental edit
```javascript
const oldTree = parser.parse(oldSrc);
const newSrc = oldSrc.slice(0, 10) + 'INSERTED' + oldSrc.slice(10);
oldTree.edit({
startIndex: 10, oldEndIndex: 10, newEndIndex: 18,
startPosition: {row: 0, column: 10},
oldEndPosition: {row: 0, column: 10},
newEndPosition: {row: 0, column: 18},
});
const newTree = parser.parse(newSrc, oldTree); // reuses unchanged subtrees
```
### rowan (rust-analyzer) typed wrapper
```rust
// Untyped GreenNode + typed SyntaxNode wrapper
use rowan::{GreenNode, SyntaxNode};
#[derive(Debug, Clone, Copy, PartialEq, Eq, Hash)]
#[repr(u16)]
enum SyntaxKind { L_PAREN, R_PAREN, IDENT, FN_KW, FN_DEF, ROOT, /* ... */ }
struct FnDef(SyntaxNode<MyLang>);
impl FnDef {
fn name(&self) -> Option<String> {
self.0.children().find(|n| n.kind() == SyntaxKind::IDENT)
.map(|n| n.text().to_string())
}
}
```
### Lossless rewrite (rename)
```rust
// Replace token in CST and reprint — preserves comments/whitespace.
fn rename(node: &SyntaxNode, old: &str, new: &str) -> String {
let mut out = String::new();
for tok in node.descendants_with_tokens() {
if let Some(t) = tok.as_token() {
if t.kind() == SyntaxKind::IDENT && t.text() == old { out.push_str(new); }
else { out.push_str(t.text()); }
}
}
out
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Compiler / type checker | AST (semantic 충분) |
| IDE / LSP / formatter | CST (lossless 필수) |
| Refactoring tool | CST + typed wrapper |
| Quick analysis script | tree-sitter query |
| New language design | rowan or tree-sitter base |
**기본값**: User-facing tool 이면 매 CST. Compiler internal pass 면 매 AST.
## 🔗 Graph
- 부모: [[Parser]]
- 변형: [[AST]]
- 응용: [[Prettier]]
## 🤖 LLM 활용
**언제**: Source-to-source transformation, IDE-grade tooling, codemods.
**언제 X**: Pure semantic analysis (AST 만 충분).
## ❌ 안티패턴
- **Regex on source**: 매 fragile — CST query 사용.
- **AST 로 formatter**: comment 손실 — CST 필수.
- **Hand-rolled parser**: error recovery 빠짐 — tree-sitter/lark 사용.
- **Full reparse on every keystroke**: incremental edit API 사용.
## 🧪 검증 / 중복
- Verified (tree-sitter docs, rust-analyzer rowan, Roslyn architecture).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — CST vs AST + tree-sitter/rowan patterns |
@@ -0,0 +1,33 @@
---
id: wiki-2026-0508-continuous-delivery-지속적-제공-cd
title: "Continuous Delivery (지속적 제공, CD)"
category: 10_Wiki/Topics
status: duplicate
canonical_id: wiki-2026-0508-continuous-delivery
duplicate_of: "[[Continuous Delivery]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, cd, devops]
last_reinforced: 2026-05-10
github_commit: pending
---
# Continuous Delivery (지속적 제공, CD)
> **이 문서는 [[Continuous Delivery]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (Korean specialization)
- 매 한국어 title 의 alias — 매 동일 concept (Continuous Delivery)
- 매 Korean wiki 검색 entry-point 로만 유지
- 매 정식 content 는 [[Continuous Delivery]] 참조
## 🔗 Graph
- 부모: [[Continuous Delivery]] (canonical)
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,147 @@
---
id: wiki-2026-0508-continuous-discovery
title: Continuous Discovery
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [continuous user research, weekly discovery, Teresa Torres method]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [product, research, discovery, ux]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: process
framework: product-discovery
---
# Continuous Discovery
## 매 한 줄
> **"매 continuous discovery 의 의미: 매 매 week 의 매 customer 와 매 conversation, 매 product decision 에 매 feed"**. 매 Teresa Torres 의 *Continuous Discovery Habits* (2021) 가 매 popularize. 매 2026 modern product team 의 매 default — 매 quarterly research → 매 weekly cadence.
## 매 핵심
### 매 Torres 의 trio
- **Product manager** + **Designer** + **Engineer** 의 매 함께 discovery
- 매 1명만 매 user 와 talk → 매 telephone game
- 매 trio 함께 → 매 shared understanding
### 매 weekly cadence
- 매 week 의 매 1+ customer interview
- 매 opportunity solution tree 의 매 update
- 매 assumption test 의 매 1+ run
### 매 Opportunity Solution Tree
- **Outcome** (top): business outcome (매 retention +5%)
- **Opportunities**: 매 customer needs / pain points
- **Solutions**: 매 ideas
- **Experiments**: 매 assumption tests
### 매 응용
1. 매 PM 의 매 weekly research routine.
2. 매 roadmap prioritization 의 매 evidence base.
3. 매 PMF (product-market fit) 의 매 ongoing validation.
## 💻 패턴
### Opportunity Solution Tree 의 매 markdown
```markdown
# Outcome: Q2 의 weekly active users +20%
## Opportunity 1: 매 user 의 매 onboarding 에 confused
- Solution 1.1: 매 interactive tutorial
- Experiment: 매 prototype A/B test
- Solution 1.2: 매 sample data preload
- Experiment: 매 5 user 의 unmoderated test
## Opportunity 2: 매 power user 의 매 keyboard shortcut 의 X
- Solution 2.1: 매 cmdK palette
- Experiment: 매 beta cohort 측정
```
### Interview 의 매 story-based prompt
```
매 X 안 됨: "Would you use feature Y?" (매 hypothetical)
매 O: "Tell me about the last time you tried to <task>.
Walk me through what happened, step by step."
```
### Assumption Mapping
```
Importance
Low ─────────► High
┌──────────┬──────────┐
Evidence │ Skip │ TEST │
Low │ │ FIRST │
├──────────┼──────────┤
Evidence │ Document│ Build │
High │ │ │
└──────────┴──────────┘
```
### 매 weekly recurring 의 calendar block
```
Mon 10am-11am: 매 trio sync (review 의 last week 결과)
Wed 2pm-3pm: 매 customer interview slot 1
Thu 2pm-3pm: 매 customer interview slot 2
Fri 11am-12pm: 매 OST update + experiment plan
```
### Research Repository (Notion / Dovetail / Reduct)
```
/research
/interviews
2026-05-08-jane-doe-acme-corp.md
2026-05-09-john-smith-beta-inc.md
/insights
onboarding-confusion-pattern.md
/opportunity-solution-tree.md
```
### Continuous Discovery 의 매 metric
```python
weekly_metrics = {
"interviews_conducted": 3, # 매 target: 매 week 1-3
"assumptions_tested": 2,
"OST_updates": 1,
"trio_alignment_score": 4.5, # 매 self-reported 1-5
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Early-stage startup | 매 founder-led, 매 5+ interviews/week |
| Growth-stage product | 매 trio cadence, 매 2-3/week |
| Enterprise B2B | 매 fewer (1-2/week), 매 deeper (60min) |
| 매 dev tool | 매 dogfood + community Discord/Slack |
| 매 heavily regulated | 매 IRB-style consent + 매 anonymization |
**기본값**: 매 weekly trio + 매 minimum 1 interview/week + 매 OST 의 living document.
## 🔗 Graph
- 변형: [[Continuous Delivery]] · [[Continuous Integration]]
## 🤖 LLM 활용
**언제**: 매 interview transcript 의 thematic coding, 매 OST 의 draft, 매 assumption 의 listing, 매 research synthesis.
**언제 X**: 매 actual customer conversation 의 X (매 LLM persona 의 fake user 의 dangerous). 매 sensitive PII 의 매 raw transcript.
## ❌ 안티패턴
- **Quarterly research**: 매 too slow, 매 stale by build time.
- **PM 만 single-handed**: 매 trio 의 X — 매 designer/eng 의 context loss.
- **매 leading question**: "Don't you hate when X?" → 매 yes-bias.
- **매 OST 의 set-and-forget**: 매 living document 의 X 인 dead artifact.
## 🧪 검증 / 중복
- Verified (Torres, *Continuous Discovery Habits*; Product Talk blog).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Continuous Discovery full content |
@@ -0,0 +1,166 @@
---
id: wiki-2026-0508-data-array-textures
title: Data Array Textures
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Texture Array, GL_TEXTURE_2D_ARRAY, WebGL2 Array Texture]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [webgl, gpu, texture, graphics, rendering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: glsl
framework: webgl2
---
# Data Array Textures
## 매 한 줄
> **"매 N 장 의 동일 size texture 의 single bind"**. 매 GL_TEXTURE_2D_ARRAY 의 atlas 의 alternative 의 sub-texel bleed 의 X 의 mipmap-safe 의 layered access 의 enable. 매 2026 년 의 WebGPU 의 default storage 의 voxel terrain, sprite atlas, lookup table 의 standard.
## 매 핵심
### 매 vs Atlas
- **Atlas**: 매 single 2D texture 의 grid. 매 mipmap 의 bleed problem.
- **Array texture**: 매 layer 의 independent. 매 mipmap-safe. 매 single bind 의 N draw call 의 1 draw call 의 reduction.
### 매 제약
- 매 모든 layer 의 same size + same format.
- 매 max_array_layers (보통 2048) 의 hardware limit.
- 매 sampler 의 layer index 의 third coord (z) 로 access.
### 매 응용
1. Voxel/Minecraft-like terrain (block type → layer index).
2. Sprite animation (frame → layer).
3. LUT (lookup table) batch.
4. Instanced material variation.
5. ML inference의 batched feature map.
## 💻 패턴
### WebGL2 array texture upload
```javascript
const gl = canvas.getContext('webgl2');
const tex = gl.createTexture();
gl.bindTexture(gl.TEXTURE_2D_ARRAY, tex);
const W = 64, H = 64, LAYERS = 16;
gl.texStorage3D(gl.TEXTURE_2D_ARRAY, 1, gl.RGBA8, W, H, LAYERS);
for (let i = 0; i < LAYERS; i++) {
const pixels = loadLayer(i); // Uint8Array(W*H*4)
gl.texSubImage3D(
gl.TEXTURE_2D_ARRAY, 0,
0, 0, i, // x, y, layer offset
W, H, 1,
gl.RGBA, gl.UNSIGNED_BYTE, pixels
);
}
gl.texParameteri(gl.TEXTURE_2D_ARRAY, gl.TEXTURE_MIN_FILTER, gl.LINEAR);
```
### GLSL 300 es sampling
```glsl
#version 300 es
precision highp float;
precision highp sampler2DArray;
uniform sampler2DArray uBlocks;
in vec2 vUV;
flat in int vBlockType;
out vec4 fragColor;
void main() {
fragColor = texture(uBlocks, vec3(vUV, float(vBlockType)));
}
```
### WebGPU equivalent
```javascript
const tex = device.createTexture({
size: [W, H, LAYERS],
format: 'rgba8unorm',
usage: GPUTextureUsage.TEXTURE_BINDING | GPUTextureUsage.COPY_DST,
dimension: '2d', // array via depthOrArrayLayers
});
device.queue.writeTexture(
{ texture: tex, origin: [0, 0, layer] },
pixels,
{ bytesPerRow: W * 4 },
{ width: W, height: H, depthOrArrayLayers: 1 }
);
```
### WGSL sampling
```wgsl
@group(0) @binding(0) var blocks: texture_2d_array<f32>;
@group(0) @binding(1) var samp: sampler;
@fragment
fn fs_main(@location(0) uv: vec2f, @location(1) @interpolate(flat) layer: u32) -> @location(0) vec4f {
return textureSample(blocks, samp, uv, layer);
}
```
### Three.js DataArrayTexture
```javascript
import { DataArrayTexture, RGBAFormat, UnsignedByteType } from 'three';
const data = new Uint8Array(W * H * LAYERS * 4);
// fill data...
const tex = new DataArrayTexture(data, W, H, LAYERS);
tex.format = RGBAFormat;
tex.type = UnsignedByteType;
tex.needsUpdate = true;
material.uniforms.uBlocks.value = tex;
```
### Mipmap generation
```javascript
gl.bindTexture(gl.TEXTURE_2D_ARRAY, tex);
gl.generateMipmap(gl.TEXTURE_2D_ARRAY);
// → each layer mipmapped independently → no atlas-style bleed
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| < 16 unique textures, dynamic | Texture atlas (simple, cached) |
| Many same-size layers, mipmap critical | Array texture |
| Different sizes / formats | Bindless / texture array of handles (WebGPU) |
| Voxel terrain | Array texture (layer = block type) |
| Cubemap variant | TextureCubeArray |
**기본값**: 매 same-size + N > 8 → array texture.
## 🔗 Graph
- 부모: [[WebGL 20|WebGL2]] · [[WebGPU]]
- 변형: [[Texture Atlas]]
- 응용: [[실시간 물리 시뮬레이션 동기화|Real-time Physics Simulation]]
- Adjacent: [[Mipmap]]
## 🤖 LLM 활용
**언제**: 매 shader code generation 의 boilerplate 의 GLSL/WGSL 의 sample. 매 LLM 의 layer index 의 binding 의 OK.
**언제 X**: 매 driver-specific 의 size limit 의 query 는 runtime 의 `getParameter`. 매 LLM 의 hardcode 의 X.
## ❌ 안티패턴
- **Mixed sizes의 attempt**: 매 array texture 의 disqualify. 매 atlas 또는 bindless.
- **Layer count 의 over 2048**: 매 split 의 multi-array-texture 또는 bindless.
- **Mipmap 의 atlas로**: 매 bleed 의 inevitable. 매 array texture 의 fix.
## 🧪 검증 / 중복
- Verified (Khronos WebGL2 spec, WebGPU spec, Three.js docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — array texture / WebGL2 + WebGPU usage |
@@ -0,0 +1,153 @@
---
id: wiki-2026-0508-debugger-techniques
title: Debugger Techniques
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Debugging, Debug Tooling]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [debugging, devtools, troubleshooting]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Multi
framework: gdb/lldb/Chrome DevTools
---
# Debugger Techniques
## 매 한 줄
> **"매 print 보다 breakpoint 가 빠르고, breakpoint 보다 reverse-debug 이 깊다."**. Debugger techniques 는 breakpoint, watchpoint, conditional, log-point, time-travel, post-mortem (core dump) 의 매 toolkit. 2026 stack: Chrome DevTools (live), VS Code DAP, gdb/lldb, rr (record-replay), Pernosco (cloud time-travel).
## 매 핵심
### 매 Breakpoint Type
- **Line**: 매 source line 정지.
- **Conditional**: 매 expression true 일 때만.
- **Log-point** ("tracepoint"): 매 정지 안하고 log 찍음.
- **Function**: 매 fn enter.
- **Watchpoint**: 매 memory address change.
- **Exception**: 매 throw caught/uncaught.
- **DOM**: 매 Chrome — node modification.
- **XHR/fetch**: 매 URL pattern.
- **Event listener**: 매 click/keydown 등.
### 매 Time-Travel Debugging
- **rr** (Linux): record once, replay backwards/forwards — 매 nondeterministic bug 의 답.
- **Pernosco**: rr trace 의 cloud UI — 매 expression 의 모든 변경 이력.
- **WinDbg TTD** (Windows).
- **Chrome DevTools "Replay panel"** (2025+ experimental).
### 매 응용
1. Heisenbug — 매 conditional + log-point.
2. Crash post-mortem — 매 core dump + gdb.
3. Performance — 매 sampling + breakpoint.
4. Memory leak — 매 heap snapshot diff.
5. Distributed — 매 OpenTelemetry trace.
## 💻 패턴
### Chrome conditional breakpoint
```javascript
// 매 in DevTools right-click line → Add conditional breakpoint
// expression: user.id === 42 && cart.total > 1000
// 또는 logpoint: console.log('cart', cart, 'time', performance.now())
```
### gdb scripted debugging
```bash
gdb --batch -x debug.gdb ./app core.12345
# debug.gdb
set pagination off
bt full
info threads
thread apply all bt
print *some_struct
```
### lldb Python script
```bash
(lldb) script
>>> frame = lldb.frame
>>> for var in frame.variables: print(var.name, var.value)
```
### rr record-replay (Linux)
```bash
rr record ./buggy_program
rr replay
# 매 in rr's gdb
(rr) reverse-continue
(rr) reverse-step
(rr) watch -l some_var
```
### Node.js inspector + Chrome
```bash
node --inspect-brk=0.0.0.0:9229 server.js
# 매 chrome://inspect
```
### Python pdb / debugpy
```python
import pdb; pdb.set_trace() # 매 classic
breakpoint() # 매 PEP 553 (python 3.7+)
# 매 VS Code remote: debugpy.listen(('0.0.0.0', 5678)); debugpy.wait_for_client()
```
### eBPF dynamic tracing
```bash
sudo bpftrace -e 'uprobe:./app:malloc { @[ustack] = count(); }'
```
### Conditional log-point pattern
```javascript
// 매 production-safe lazy log — no perf cost when disabled
if (DEBUG) console.log('state', JSON.stringify(state));
// 매 better — feature flag gated
if (flags.debugCart) logger.debug({ cart, user });
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| Web (Chromium) | DevTools Sources panel |
| Node.js | --inspect + DevTools / VS Code |
| C/C++ Linux | gdb / lldb + rr |
| C/C++ macOS | lldb + Instruments |
| Python | debugpy + VS Code |
| Heisenbug | rr + Pernosco |
| Production crash | core dump + gdb |
| Distributed | OTel trace |
**기본값**: 매 IDE breakpoint → 부족시 rr / TTD.
## 🔗 Graph
- 부모: [[중단점 (Breakpoints)]]
- 변형: [[동적 런타임 분석 (Dynamic Runtime Analysis)]]
- 응용: [[Flame_Graphs]] · [[Logging_and_Error_Handling]]
- Adjacent: [[Analyze runtime performance]]
## 🤖 LLM 활용
**언제**: stack trace 해석, log clustering, hypothesis generation, repro script.
**언제 X**: 매 step-into 같은 deterministic 작업 — IDE 가 직접.
## ❌ 안티패턴
- **printf-only**: 매 build cycle 낭비 — debugger 사용.
- **Production breakpoint**: 매 thread freeze — log-point 사용.
- **No source map**: 매 minified frame 해독 불가.
- **Trust gut without repro**: 매 unreliable repro 면 가설 무한 반복.
## 🧪 검증 / 중복
- Verified: Chrome DevTools docs; gdb manual; rr-project.org; Pernosco docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — breakpoint taxonomy + rr/TTD + multi-lang |
@@ -0,0 +1,189 @@
---
id: wiki-2026-0508-deepfake-detection
title: Deepfake Detection
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Deepfake Detection, Synthetic Media Detection, AI-Generated Content Detection]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, ml, forensics, deepfake, detection]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Python
framework: PyTorch
---
# Deepfake Detection
## 매 한 줄
> **"매 generative model 의 fingerprint 의 수확"**. 2017 FakeApp 의 등장 이후 detection 의 cat-and-mouse race 가 시작되었고, 2026 modern detector 는 frequency-domain artifacts, biological signals (PPG, eye blink), 그리고 self-supervised representation 의 ensemble 의 통해 95%+ AUC 의 달성 — but cross-model generalization 의 여전히 매 open problem.
## 매 핵심
### 매 Detection 패러다임
- **Frequency-domain**: GAN/Diffusion 의 upsampling artifact (DCT spectrum 의 grid pattern, FFT 의 high-freq 결손).
- **Biological signal**: heart-rate (rPPG), micro-expression, eye blink frequency 의 unnatural pattern.
- **Identity consistency**: face embedding 의 video-level temporal drift.
- **Self-supervised**: CLIP/DINOv2 feature 의 OOD detection.
### 매 Generation 종류
- **Face swap**: DeepFaceLab, FaceFusion, Roop.
- **Face reenactment**: First Order Motion Model, LivePortrait (2024).
- **Full-body**: Wav2Lip, SadTalker, EMO (Alibaba 2024).
- **Diffusion-based**: Stable Video Diffusion, Sora (OpenAI 2024), Veo 3 (Google 2025).
### 매 응용
1. Newsroom 의 fact-checking pipeline (Reuters, AP).
2. Social platform 의 watermark + detection (Meta, TikTok, X).
3. Identity verification (KYC, banking — Persona, Onfido).
4. Forensic 증거 분석 (court-admissible chain of custody).
## 💻 패턴
### Frequency-domain CNN (Frank et al. baseline)
```python
import torch
import torch.nn as nn
from torch.fft import fft2, fftshift
class FrequencyDeepfakeDetector(nn.Module):
def __init__(self, num_classes=2):
super().__init__()
self.backbone = nn.Sequential(
nn.Conv2d(1, 32, 3, padding=1), nn.ReLU(),
nn.Conv2d(32, 64, 3, padding=1), nn.ReLU(),
nn.AdaptiveAvgPool2d(8), nn.Flatten(),
nn.Linear(64 * 64, num_classes),
)
def forward(self, x): # x: (B, 3, H, W) RGB
gray = x.mean(1, keepdim=True)
spec = fftshift(fft2(gray)).abs().log1p()
return self.backbone(spec)
```
### rPPG-based liveness (heart-rate from face video)
```python
import numpy as np
from scipy.signal import butter, filtfilt
def extract_rppg(face_frames, fps=30):
# POS algorithm — Wang et al. 2017
rgb_signal = np.stack([f.reshape(-1, 3).mean(0) for f in face_frames])
rgb_norm = rgb_signal / rgb_signal.mean(0)
proj = rgb_norm @ np.array([[0, 1, -1], [-2, 1, 1]]).T
s = proj[:, 0] + (proj[:, 0].std() / proj[:, 1].std()) * proj[:, 1]
b, a = butter(4, [0.7, 4.0], btype='band', fs=fps)
return filtfilt(b, a, s - s.mean())
def is_live(rppg, fps=30):
fft = np.abs(np.fft.rfft(rppg))
freqs = np.fft.rfftfreq(len(rppg), 1/fps) * 60 # BPM
peak_bpm = freqs[fft.argmax()]
return 50 <= peak_bpm <= 180 # 매 plausible HR range
```
### CLIP-based zero-shot detector
```python
import open_clip
import torch
model, _, preprocess = open_clip.create_model_and_transforms(
'ViT-L-14', pretrained='laion2b_s32b_b82k')
tokenizer = open_clip.get_tokenizer('ViT-L-14')
prompts = ["a real photograph", "an AI-generated image",
"a deepfake", "a synthetic face"]
text = tokenizer(prompts)
text_features = model.encode_text(text)
text_features /= text_features.norm(dim=-1, keepdim=True)
def score(image_pil):
img = preprocess(image_pil).unsqueeze(0)
img_feat = model.encode_image(img)
img_feat /= img_feat.norm(dim=-1, keepdim=True)
sims = (img_feat @ text_features.T).softmax(-1)
return sims[0, 1:].sum().item() # 매 fake probability
```
### Temporal consistency (face embedding drift)
```python
from facenet_pytorch import InceptionResnetV1
embedder = InceptionResnetV1(pretrained='vggface2').eval()
def temporal_drift(face_crops):
embs = embedder(torch.stack(face_crops))
embs = embs / embs.norm(dim=-1, keepdim=True)
consec_sim = (embs[:-1] * embs[1:]).sum(-1)
# 매 swapped face 의 unnatural jitter 의 detect
return 1.0 - consec_sim.mean().item()
```
### Watermark verification (C2PA / SynthID)
```python
import hashlib
from cryptography.hazmat.primitives.asymmetric import ed25519
def verify_c2pa_manifest(manifest_bytes, signature, public_key):
try:
public_key.verify(signature, manifest_bytes)
return True
except Exception:
return False # 매 manifest 의 tampered 또는 missing
```
### Ensemble fusion (production)
```python
def ensemble_decision(image, video_clip):
scores = {
'freq': freq_detector(image),
'clip': clip_detector(image),
'rppg': 1.0 - is_live_score(video_clip),
'temporal': temporal_drift(extract_faces(video_clip)),
}
weights = {'freq': 0.3, 'clip': 0.25, 'rppg': 0.25, 'temporal': 0.2}
return sum(w * scores[k] for k, w in weights.items())
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Real-time KYC | rPPG + active liveness challenge |
| Static image forensic | Frequency CNN + CLIP zero-shot |
| Video newsroom | Ensemble (freq + temporal + watermark) |
| Cross-generator generalization | Self-supervised foundation model |
| High-stakes legal | Multi-modal + chain-of-custody + C2PA |
**기본값**: ensemble of frequency + foundation-model + watermark verification.
## 🔗 Graph
- 부모: [[Computer Vision]]
- 응용: [[Content Moderation]]
- Adjacent: [[C2PA]]
## 🤖 LLM 활용
**언제**: feature engineering 의 brainstorm, dataset curation script, false-positive 분석.
**언제 X**: production detection model 의 직접 inference (LLM 의 vision 의 reliable detector 의 X — specialized model 의 사용).
## ❌ 안티패턴
- **Single-detector reliance**: GAN-trained detector 의 diffusion-generated content 의 fail.
- **No cross-generator eval**: train/test 의 same generator 의 inflated metric.
- **Ignoring compression artifacts**: JPEG/H.264 의 frequency signal 의 destroy.
- **Adversarial blindness**: detector 의 adversarial perturbation 의 robust 의 X.
- **Watermark-only**: open-source generator 의 watermark 의 strip.
## 🧪 검증 / 중복
- Verified (FaceForensics++ benchmark, DFDC, Frank et al. ICML 2020, C2PA spec v2.1).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — frequency/biological/CLIP detection patterns + ensemble |
@@ -0,0 +1,155 @@
---
id: wiki-2026-0508-devsecops-framework
title: DevSecOps Framework
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [DevSecOps, Shift-Left Security, Secure SDLC]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [devsecops, security, shift-left, sdlc]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: YAML/Python
framework: GitHub Actions/Semgrep/Trivy
---
# DevSecOps Framework
## 매 한 줄
> **"매 security 가 PR 단계부터 매일 실행되는 자동 체크가 되는 것."**. DevSecOps 는 매 plan-code-build-test-release-deploy-operate-monitor 8단계 의 매 step 마다 security control 을 embed 하는 매 shift-left framework. 2026 표준: SAST + SCA + IaC scan + secret scan + DAST + RASP + supply-chain (SLSA L3) + ASPM platform.
## 매 핵심
### 매 8-Stage Embed
1. **Plan**: threat model (STRIDE), security stories.
2. **Code**: IDE plugin (Semgrep, SonarLint), pre-commit (lint-staged + secret).
3. **Build**: SBOM (Syft), reproducible build, sign (cosign).
4. **Test**: SAST (Semgrep, CodeQL), SCA (Trivy, Snyk), IaC (Checkov).
5. **Release**: provenance (SLSA), policy (OPA gatekeeper).
6. **Deploy**: admission control, signed image verify, secrets via Vault.
7. **Operate**: RASP, WAF, runtime detection (Falco).
8. **Monitor**: SIEM (Splunk), anomaly detection, incident response.
### 매 Tool Categories 2026
- **SAST**: Semgrep, CodeQL, Snyk Code.
- **SCA**: Trivy, Snyk Open Source, Dependabot.
- **DAST**: ZAP, Burp, Nuclei.
- **IaC**: Checkov, tfsec, KICS.
- **Secret scan**: gitleaks, TruffleHog.
- **Container**: Trivy, Grype.
- **K8s**: kube-bench, Falco, Kyverno.
- **ASPM**: Phoenix, Apiiro, ArmorCode — aggregate + prioritize.
### 매 응용
1. Web app secure SDLC.
2. K8s cluster hardening.
3. Cloud infra (Terraform/Pulumi) compliance.
4. Container registry policy.
5. Supply-chain integrity (SLSA L3).
## 💻 패턴
### GitHub Actions DevSecOps gate
```yaml
name: secure-pr
on: pull_request
permissions: { contents: read, security-events: write, id-token: write }
jobs:
scan:
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
- uses: gitleaks/gitleaks-action@v2 # 매 secrets
- uses: returntocorp/semgrep-action@v1 # 매 SAST
with: { config: 'p/owasp-top-ten p/security-audit' }
- uses: aquasecurity/trivy-action@master # 매 SCA + container
with: { scan-type: fs, severity: 'CRITICAL,HIGH', exit-code: 1 }
- uses: bridgecrewio/checkov-action@master # 매 IaC
```
### Pre-commit secret scan
```yaml
# .pre-commit-config.yaml
repos:
- repo: https://github.com/gitleaks/gitleaks
rev: v8.18.0
hooks: [{ id: gitleaks }]
```
### OPA admission policy (K8s)
```rego
package k8s.image
violation[{"msg": msg}] {
input.review.object.spec.containers[_].image
not startswith(input.review.object.spec.containers[_].image, "ghcr.io/myorg/")
msg := "image must come from approved registry"
}
```
### Cosign verify in admission
```yaml
apiVersion: policy.sigstore.dev/v1beta1
kind: ClusterImagePolicy
spec:
images: [{ glob: "ghcr.io/myorg/**" }]
authorities:
- keyless:
identities: [{ issuer: "https://token.actions.githubusercontent.com", subject: ".*myorg/.*" }]
```
### Falco runtime detection rule
```yaml
- rule: Shell in container
desc: Detect shell exec inside container
condition: container.id != host and proc.name in (bash, sh, zsh)
output: "Shell %proc.name in container=%container.name image=%container.image.repository"
priority: WARNING
```
### SBOM + provenance attest
```bash
syft packages oci:./image.tar -o spdx-json > sbom.spdx.json
cosign attest --predicate sbom.spdx.json --type spdx ghcr.io/org/app@sha256:...
```
## 매 결정 기준
| 상황 | Tool stack |
|---|---|
| TS/Python monorepo | Semgrep + Trivy + gitleaks |
| Terraform cloud infra | Checkov + tfsec |
| K8s cluster | Falco + Kyverno + cosign |
| Compliance heavy | ASPM platform (Phoenix/Apiiro) |
| Air-gapped / regulated | Semgrep self-host + Trivy DB mirror |
**기본값**: 매 Semgrep + Trivy + gitleaks + Checkov + cosign + Falco.
## 🔗 Graph
- 부모: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]] · [[안전한 소프트웨어 개발 수명주기(SSDLC)]]
- 변형: [[애플리케이션_보안_태세_관리ASPM]]
- 응용: [[SAST]] · [[보안 및 시스템 신뢰성 표준|DAST]] · [[SCA_Fundamentals|SCA]] · [[Secret_Management]]
- Adjacent: [[보안 및 시스템 신뢰성 표준|Zero-Trust Architecture]] · [[CI_CD_Pipeline]]
## 🤖 LLM 활용
**언제**: vuln triage, false-positive filter, remediation PR draft, threat-model brainstorm.
**언제 X**: 매 actual scan — specialized engine 이 빠르고 정확.
## ❌ 안티패턴
- **Security as gate-only**: 매 alert flood 만 — fix automation 없음.
- **Tool sprawl**: 매 5개 SAST 가 noise — ASPM 으로 dedupe.
- **No baseline**: 매 legacy CVE 전체가 critical — accept + monitor.
- **Bypass culture**: 매 dev 가 `// eslint-disable security/*` — guard 무력화.
## 🧪 검증 / 중복
- Verified: NIST SSDF SP 800-218; OWASP DevSecOps maturity; SLSA v1.0; Falco docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — 8-stage + tool stack 2026 |
@@ -0,0 +1,160 @@
---
id: wiki-2026-0508-digital-intellectual-property-ri
title: Digital Intellectual Property Rights
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Digital IP, Software IP, Digital Rights]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [legal, ip, licensing, copyright]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: legal
framework: licenses
---
# Digital Intellectual Property Rights
## 매 한 줄
> **"매 digital IP 의 의미: 매 software / data / model 의 매 ownership, license, attribution 권리"**. 매 copyright (default) + 매 license (grant) + 매 patent (algorithm) + 매 trade secret 의 4 axis. 매 2026 AI 시대 의 매 training data 권리, 매 model weights 권리, 매 LLM output 권리 의 매 hot frontier.
## 매 핵심
### 매 4 axis
- **Copyright**: 매 expression (code, art, text) 의 default 보호 — 매 author 의 lifetime + 70년
- **License**: 매 author 의 매 grant — MIT, Apache, GPL, proprietary
- **Patent**: 매 invention (algorithm, system) — 매 20년, 매 applied required
- **Trade secret**: 매 confidential 정보 — 매 indefinite, 매 reasonable protection 요구
### Open Source 의 매 spectrum
- **Permissive**: MIT, Apache 2.0, BSD — 매 commercial use OK
- **Weak copyleft**: LGPL, MPL — 매 modified file 만 share
- **Strong copyleft**: GPL, AGPL — 매 entire derivative work share
- **Source-available**: BUSL, SSPL — 매 commercial restriction (NOT OSI-approved)
### 매 AI/ML specific (2026)
- **Training data**: 매 fair use 논쟁 (NYT v. OpenAI, Authors Guild v. Anthropic)
- **Model weights**: 매 copyrightable? (매 unsettled, 매 case law evolving)
- **AI output**: 매 US Copyright Office (2023) — 매 human authorship required
- **Style transfer**: 매 artist 의 매 trademark 가능성
### 매 응용
1. 매 OSS dependency audit (license compatibility).
2. 매 employee invention assignment.
3. 매 LLM output 의 commercial use 결정.
## 💻 패턴
### License File 의 매 MIT
```
MIT License
Copyright (c) 2026 Acme Corp
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND...
```
### SPDX 의 매 file header
```typescript
// SPDX-License-Identifier: Apache-2.0
// Copyright 2026 Acme Corp
```
### License Audit 의 매 tooling
```bash
# 매 npm 의 license check
npx license-checker --production --summary
# 매 SBOM 생성 (CycloneDX)
npx @cyclonedx/cyclonedx-npm --output-format JSON --output-file sbom.json
# 매 incompatible license 의 매 fail
npx license-checker --failOn 'GPL-3.0;AGPL-3.0'
```
### CLA / DCO (Contributor)
```bash
# DCO sign-off
git commit -s -m "feat: add foo"
# Signed-off-by: Jane <jane@acme.com>
```
### REUSE Compliance (EU 표준)
```toml
# .reuse/dep5
Format: https://www.debian.org/doc/packaging-manuals/copyright-format/1.0/
Files: src/*
Copyright: 2026 Acme Corp
License: Apache-2.0
Files: vendor/*
Copyright: 2024 Original Author
License: MIT
```
### AI Model Card 의 매 license clarity
```markdown
# Model Card: acme-llm-v2
## License
- **Weights**: Llama 3 Community License (Meta)
- **Code**: Apache 2.0 (Acme)
- **Training data**: Mixed (CC-BY, public domain, licensed proprietary)
## Permitted Use
- Commercial use < 700M MAU OK (per Llama license)
- Fine-tuning OK
- Redistributing weights: see Llama license restrictions
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Internal-only project | 매 proprietary, 매 no public license |
| Open source library | 매 MIT (max adoption) / Apache 2.0 (patent grant) |
| Want commercial fork prevention | 매 AGPL / BUSL |
| Enterprise SaaS | 매 proprietary EULA + 매 SOC2 |
| AI model release | 매 OpenRAIL / 매 community license + 매 model card |
**기본값**: 매 Apache 2.0 (OSS) / 매 proprietary EULA (commercial).
## 🔗 Graph
- 변형: [[Copyright]]
- 응용: [[SBOM]]
- Adjacent: [[GDPR]] · [[Ensuring Data Privacy]]
## 🤖 LLM 활용
**언제**: 매 license compatibility 의 first-pass check, 매 EULA draft 의 starter, 매 model card 의 generation.
**언제 X**: 매 actual legal advice — 매 lawyer required. 매 jurisdiction-specific (US v. EU v. JP) 의 매 LLM error 위험.
## ❌ 안티패턴
- **매 license 의 X (no LICENSE file)**: 매 default = all rights reserved → 매 사용 불가.
- **매 GPL code 의 매 proprietary product 에 mix**: 매 entire codebase 의 GPL infect.
- **매 LLM output 의 무비판 commercial 사용**: 매 training data attribution 위험.
- **매 employee NDA 없음**: 매 trade secret 의 protection 불가.
## 🧪 검증 / 중복
- Verified (OSI license list, SPDX, US Copyright Office AI guidance 2023).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Digital IP rights full content |
@@ -0,0 +1,137 @@
---
id: wiki-2026-0508-digital-thread-integration
title: Digital Thread Integration
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Digital Thread, Industrial Data Thread]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [iiot, digital-thread, manufacturing, plm]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Python/SQL
framework: OPC UA/MQTT/Kafka
---
# Digital Thread Integration
## 매 한 줄
> **"매 product lifecycle 의 모든 data 가 single linked thread 로 흐르는 것."**. Digital Thread 는 design (CAD) → engineering (PLM) → manufacturing (MES) → operations (IoT) → service (CRM) 까지 매 traceable, queryable 하게 연결하는 매 manufacturing/aerospace 의 backbone. 2026 의 standard: ISA-95 + OPC UA + Asset Administration Shell (AAS) + RAMI 4.0 + IDS data spaces.
## 매 핵심
### 매 Digital Thread vs Digital Twin
- **Thread**: 매 data lineage — design intent ↔ as-built ↔ as-maintained.
- **Twin**: 매 simulation model of a specific asset.
- **관계**: Twin 은 Thread 의 cross-section snapshot.
### 매 Layer Stack
1. **Edge**: PLC, sensor, OPC UA server.
2. **Connectivity**: MQTT, OPC UA, MTConnect.
3. **Stream**: Kafka / Pulsar — high-throughput.
4. **Storage**: time-series (InfluxDB, TimescaleDB), data lake (Iceberg).
5. **Semantic**: Asset Administration Shell, ontology (W3C SOSA/SSN).
6. **Application**: PLM (Teamcenter, Windchill), MES, ERP.
### 매 응용
1. Aerospace — 매 part traceability, certification.
2. Automotive — 매 EV battery passport (EU 2027 mandate).
3. Industrial maintenance — 매 predictive + service history.
4. Pharma — 매 batch genealogy.
5. EU Digital Product Passport — 매 sustainability.
## 💻 패턴
### OPC UA client (Python)
```python
from asyncua import Client
async def main():
async with Client(url="opc.tcp://plant.local:4840") as c:
node = c.get_node("ns=2;s=Line1.Press.Temp")
async for v in node.subscribe_data_change(callback):
pass
```
### MQTT Sparkplug B (manufacturing-standard payload)
```python
import paho.mqtt.client as mqtt
import sparkplug_b as sp
payload = sp.getDdataPayload()
sp.addMetric(payload, "Temp", None, sp.MetricDataType.Float, 72.5)
client.publish("spBv1.0/PlantA/DDATA/Edge1/Press1", payload.SerializeToString())
```
### Asset Administration Shell submodel
```json
{
"idShort": "Nameplate",
"submodelElements": [
{"idShort":"ManufacturerName","value":"Acme"},
{"idShort":"SerialNumber","value":"SN-A1B2"},
{"idShort":"YearOfConstruction","value":"2026"}
]
}
```
### Kafka pipeline edge → lake
```python
from confluent_kafka import Producer
import pyarrow.parquet as pq
p = Producer({'bootstrap.servers':'kafka:9092','compression.type':'zstd'})
p.produce('plant.line1.temp', key=part_id, value=msg.SerializeToString())
# downstream Flink/Spark → Iceberg table
```
### Digital Product Passport (EU 2027)
```json
{
"productId": "urn:gtin:01234567890128",
"carbonFootprintKg": 12.4,
"materials": [{"name":"Li","massGrams":1200}],
"recycledContentPercent": 18,
"linkedTwin": "urn:twin:battery:SN-A1B2"
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Field bus modernization | OPC UA |
| IoT-style telemetry | MQTT Sparkplug B |
| Cross-vendor semantics | AAS / IDS |
| Stream backbone | Kafka / Pulsar |
| Time-series store | TimescaleDB / Influx |
| Lake | Iceberg + Trino |
**기본값**: 매 OPC UA + MQTT Sparkplug B → Kafka → Iceberg.
## 🔗 Graph
- 부모: [[Digital Twins]] · [[Digital Twins|Digital-Twin-Technology]]
- 변형: [[클라우드 인프라 및 IaC 운영 표준|IoT]]
- 응용: [[Engineering Metrics (DORA)]]
- Adjacent: [[Digital Intellectual Property Rights]]
## 🤖 LLM 활용
**언제**: ontology mapping, anomaly summary, maintenance work-order draft.
**언제 X**: 매 safety-critical PLC logic — formal verification 만.
## ❌ 안티패턴
- **Polling 오버**: 매 OPC UA subscribe 사용 — pub/sub.
- **Untimestamped data**: 매 Thread 의 핵심은 시간 lineage.
- **Vendor lock**: 매 proprietary protocol — open standards 사용.
- **No identity**: 매 GS1, urn 등 stable id 필수.
## 🧪 검증 / 중복
- Verified: ISA-95 spec; OPC UA Part 1; Plattform Industrie 4.0 AAS spec; EU DPP regulation 2024.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Thread vs Twin + OPC UA/MQTT/AAS |
@@ -0,0 +1,144 @@
---
id: wiki-2026-0508-dopamine
title: Dopamine
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Reward System, Reinforcement Signal, Prediction Error]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [neuroscience, reinforcement-learning, motivation, ux]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: rl
---
# Dopamine
## 매 한 줄
> **"매 reward prediction error 의 signal"**. 매 dopamine 의 modern view 는 pleasure 의 X, 매 *expected vs actual reward 의 차이* 의 broadcast. 매 Schultz (1997) 의 monkey VTA recording 의 RL 의 TD-error 의 isomorphism 의 establish. 매 product UX, addiction design, RL algorithm 의 shared substrate.
## 매 핵심
### 매 RPE (Reward Prediction Error)
- **Positive RPE**: 매 expected 보다 better. 매 dopamine burst.
- **Zero RPE**: 매 fully predicted. 매 baseline firing.
- **Negative RPE**: 매 expected 보다 worse. 매 firing dip.
### 매 RL 의 TD-error 와 의 mapping
- 매 δ = r + γV(s') − V(s).
- 매 dopamine neuron 의 firing rate 의 δ 의 encode (Schultz, Dayan, Montague 1997).
### 매 응용
1. Variable-ratio schedule (slot machine, social media feed) — 매 maximal RPE.
2. Habit formation (intermittent reward).
3. Anhedonia / addiction 의 dopaminergic dysregulation.
4. RL agent design (curiosity, intrinsic motivation).
## 💻 패턴
### TD-learning (dopamine-analog)
```python
import numpy as np
def td_update(V, s, r, s_next, alpha=0.1, gamma=0.9):
"""V: value table. δ = TD error = 'dopamine signal'."""
delta = r + gamma * V[s_next] - V[s] # ← RPE
V[s] += alpha * delta
return delta # log this; it's the 'dopamine'
V = np.zeros(10)
for episode in range(1000):
s, r, s_next = sample_transition()
rpe = td_update(V, s, r, s_next)
```
### Curiosity-driven exploration (intrinsic dopamine analog)
```python
# Random Network Distillation (Burda 2018)
class RND(nn.Module):
def __init__(self):
super().__init__()
self.target = nn.Sequential(nn.Linear(64, 128), nn.ReLU(), nn.Linear(128, 64))
self.predictor = nn.Sequential(nn.Linear(64, 128), nn.ReLU(), nn.Linear(128, 64))
for p in self.target.parameters(): p.requires_grad = False
def intrinsic_reward(self, obs):
with torch.no_grad():
target = self.target(obs)
pred = self.predictor(obs)
return ((target - pred) ** 2).mean(-1) # novelty bonus
```
### Variable-ratio schedule simulator
```python
def variable_ratio_session(p_reward=0.1, n_pulls=100):
rpe_log = []
expected = p_reward # learned expectation
for _ in range(n_pulls):
r = 1.0 if np.random.rand() < p_reward else 0.0
rpe = r - expected
expected += 0.05 * rpe # slow learning
rpe_log.append(rpe)
return rpe_log
# Pattern: high-amplitude RPE persists → "addictive" engagement
```
### Hyperbolic discounting (dopamine-future)
```python
def hyperbolic_value(reward, delay, k=0.1):
"""Real human/animal — closer to hyperbolic than exponential."""
return reward / (1 + k * delay)
```
### Opponent process (reward + aversion)
```python
# Two-system: dopamine (reward) + serotonin (aversion / patience)
def dual_system_update(V_reward, V_aversion, r_pos, r_neg, s, s_next, alpha=0.1, gamma=0.9):
delta_reward = r_pos + gamma * V_reward[s_next] - V_reward[s]
delta_aversion = r_neg + gamma * V_aversion[s_next] - V_aversion[s]
V_reward[s] += alpha * delta_reward
V_aversion[s] += alpha * delta_aversion
return delta_reward, delta_aversion
```
## 매 결정 기준
| 상황 | Insight |
|---|---|
| Habit-forming product | Variable-ratio reward (Slot machine schedule) |
| Sustained engagement | Mix predictable + unpredictable wins |
| Avoid burnout | Avoid pure RPE-maximization (ethical concern) |
| RL exploration stuck | Add intrinsic reward (RND, ICM) |
| Anhedonia in user | Reduce expectation, surprise with low-cost wins |
**기본값**: 매 RPE-aware design — but 매 ethics 의 weight (manipulation 의 risk).
## 🔗 Graph
- 부모: [[Reinforcement Learning]]
- 응용: [[Habit Formation]] · [[Game Design]] · [[Recommender Systems]]
- Adjacent: [[TD-Learning]] · [[Behavioral Economics]]
## 🤖 LLM 활용
**언제**: 매 product UX 의 retention mechanic 의 audit. 매 dark-pattern 의 detection.
**언제 X**: 매 clinical advice. 매 LLM 의 medical claim 의 X.
## ❌ 안티패턴
- **Dopamine = pleasure 의 simplification**: 매 X. 매 RPE 의 signal — pleasure 는 separate (opioid).
- **Pure exploitation (no novelty)**: 매 user 의 RPE 의 0 의 disengage.
- **Manipulative dark pattern**: 매 ethical violation. 매 design 의 audit 의 mandatory.
## 🧪 검증 / 중복
- Verified (Schultz 1997 Science, Sutton & Barto 2018, Berridge 2007).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — RPE / TD-learning isomorphism + UX implication |
@@ -0,0 +1,148 @@
---
id: wiki-2026-0508-draw-call
title: Draw Call
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Drawcall, GPU Submit, Render Command]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [graphics, gpu, performance, rendering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C++/Rust
framework: Vulkan/Metal/D3D12/WebGPU
---
# Draw Call
## 매 한 줄
> **"매 CPU 가 GPU 에게 매 한 batch 를 그리라고 매 instructing 하는 single command"**. 1990s OpenGL `glDrawArrays` 시대의 매 ms-cost overhead 가 매 modern explicit API (Vulkan/D3D12/Metal/WebGPU) + bindless + GPU-driven rendering 으로 매 micro-second 수준으로 떨어짐. 매 2026 — `vkCmdDrawIndexedIndirectCount` + mesh shader 가 매 norm.
## 매 핵심
### 매 anatomy
- Set pipeline (shader, blend, depth state).
- Bind resources (vertex/index buffer, uniform, texture).
- Issue draw (`drawIndexed`, `dispatch`).
- Submit to queue.
### 매 cost source
- **Driver validation**: legacy GL 의 매 main bottleneck.
- **State change**: pipeline / RT / descriptor switch.
- **CPU↔GPU sync**: fence wait, map/unmap.
- **Command recording**: 매 modern API 에서 매 thread 분산 가능.
### 매 응용
1. Draw call 수 줄임 → frame time 직접 감소.
2. Batching (instancing, atlas, indirect).
3. GPU-driven culling (compute → indirect).
## 💻 패턴
### Vulkan minimal draw
```cpp
vkCmdBindPipeline(cmd, VK_PIPELINE_BIND_POINT_GRAPHICS, pipeline);
VkBuffer vbs[] = {vertexBuf}; VkDeviceSize off[] = {0};
vkCmdBindVertexBuffers(cmd, 0, 1, vbs, off);
vkCmdBindIndexBuffer(cmd, indexBuf, 0, VK_INDEX_TYPE_UINT32);
vkCmdBindDescriptorSets(cmd, ..., 0, 1, &set, 0, nullptr);
vkCmdDrawIndexed(cmd, indexCount, instanceCount, 0, 0, 0);
```
### Instancing (1 call → N objects)
```glsl
// vertex shader
layout(location = 0) in vec3 pos;
layout(location = 4) in mat4 modelMatrix; // per-instance
void main() { gl_Position = vp * modelMatrix * vec4(pos, 1); }
```
```cpp
// CPU side
vkCmdDrawIndexed(cmd, idxCount, 10000, 0, 0, 0); // 10k objects, 1 draw
```
### Indirect draw (GPU-driven)
```cpp
struct VkDrawIndexedIndirectCommand {
uint32_t indexCount, instanceCount, firstIndex;
int32_t vertexOffset; uint32_t firstInstance;
};
// Compute shader culls & writes commands + count to GPU buffer.
// CPU just calls:
vkCmdDrawIndexedIndirectCount(cmd, drawBuf, 0, countBuf, 0, MAX_DRAWS, sizeof(Cmd));
```
### Bindless (descriptor indexing)
```glsl
#extension GL_EXT_nonuniform_qualifier : require
layout(set=0, binding=0) uniform sampler2D textures[];
layout(push_constant) uniform PC { uint texIndex; };
void main() { color = texture(textures[nonuniformEXT(texIndex)], uv); }
```
### Mesh shader (DX12 / Vulkan)
```glsl
#version 460
#extension GL_EXT_mesh_shader : require
layout(local_size_x = 32) in;
layout(triangles, max_vertices = 64, max_primitives = 124) out;
void main() {
SetMeshOutputsEXT(vertCount, primCount);
// amplify / cull per meshlet, no IA stage
}
```
### Multi-thread command recording (Vulkan)
```cpp
// 1 secondary CB per thread
parallel_for(0, N, [&](int i) {
VkCommandBuffer sec = secondaryCBs[threadId];
vkBeginCommandBuffer(sec, ...);
record_draws_for_chunk(sec, chunk[i]);
vkEndCommandBuffer(sec);
});
vkCmdExecuteCommands(primaryCB, N, secondaryCBs.data());
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 同 mesh 수천 개 | Instancing |
| Diverse mesh, frustum cullable | GPU-driven indirect + compute culling |
| Many materials | Bindless texture + uber-shader |
| Highly detailed geometry | Mesh shader + meshlet |
| Legacy GL/GLES | Atlas + state sort + minimize binds |
**기본값**: Modern → indirect + bindless. Legacy → batch by state.
## 🔗 Graph
- 부모: [[GPU Pipeline]] · [[Real-time Rendering]]
- 변형: [[Indirect Draw]]
- 응용: [[Frustum Culling]] · [[Geometry Merging]]
- Adjacent: [[Vulkan]] · [[Metal]] · [[WebGPU]]
## 🤖 LLM 활용
**언제**: Renderer architecture, perf budget 분석, profiling 결과 해석.
**언제 X**: Game design / art direction.
## ❌ 안티패턴
- **One draw per object**: legacy 패턴 — instancing/indirect 사용.
- **Excessive state changes**: shader/pipeline 매 frame 수천 번 swap.
- **CPU-side culling 만**: GPU 보내서 매 compute 로 culling.
- **Map/unmap loop**: persistent mapped buffer + ring 사용.
- **Single thread record**: secondary CB + parallel_for.
## 🧪 검증 / 중복
- Verified (Vulkan/D3D12 spec, Khronos best practices, GPU Zen).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — draw call cost + indirect/bindless/mesh shader |
@@ -0,0 +1,199 @@
---
id: wiki-2026-0508-edtech-industry-trends
title: Edtech Industry Trends
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [EdTech Trends, Education Technology, Learning Tech]
duplicate_of: none
source_trust_level: B
confidence_score: 0.8
verification_status: applied
tags: [edtech, education, ai-tutor, lms, trends]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: Next.js
---
# Edtech Industry Trends
## 매 한 줄
> **"매 AI tutor 의 mass adoption + skill-based credentialing 의 rise"**. 2020 COVID 의 remote-learning 폭발 이후, 2023 GPT-4 의 ChatGPT 의 학습 의 disrupt — 2026 는 personalized AI tutor (Khanmigo, Duolingo Max), micro-credential (Coursera, Open Badges), 그리고 LXP (Learning Experience Platform) 의 LMS 의 대체 의 dominate trend.
## 매 핵심
### 매 2026 핵심 trend
- **AI tutor 의 ubiquity**: Khanmigo, Duolingo Max, ChatGPT for Education.
- **Adaptive learning**: knowledge tracing (DKT, BKT), spaced-repetition.
- **Micro-credential**: stackable certificate, Open Badges 3.0, blockchain anchored.
- **VR/AR**: Meta Quest for Education, immersive lab.
- **Skills-based hiring**: degree-optional, portfolio + assessment.
- **Decline of MOOC giants**: Coursera/edX 의 plateau, niche bootcamp 의 rise.
### 매 Tech stack
- **Frontend**: Next.js, React Native, Unity (immersive).
- **AI**: GPT-5, Claude Opus 4.7, Gemini 2.5, fine-tuned tutor model.
- **Backend**: PostgreSQL + pgvector, Redis, Kafka.
- **Standard**: LTI 1.3, xAPI/cmi5, Open Badges, IMS Caliper.
### 매 응용
1. K-12 의 personalized math tutor (Khan Academy).
2. Higher-ed 의 AI TA (Georgia Tech Jill Watson 후속).
3. Corporate L&D 의 skill graph (Degreed, Cornerstone).
4. Language (Duolingo, Speak) 의 conversational AI.
## 💻 패턴
### LTI 1.3 의 LMS launch
```typescript
import jwt from 'jsonwebtoken';
export async function ltiLaunch(req, res) {
const idToken = req.body.id_token;
const decoded = jwt.verify(idToken, getKey, {
algorithms: ['RS256'],
audience: process.env.LTI_CLIENT_ID,
issuer: process.env.LTI_PLATFORM_ISSUER,
});
const user = {
sub: decoded.sub,
role: decoded['https://purl.imsglobal.org/spec/lti/claim/roles'],
contextId: decoded['https://purl.imsglobal.org/spec/lti/claim/context'].id,
};
req.session.lti = user;
res.redirect('/activity');
}
```
### Adaptive item selection (BKT)
```typescript
// Bayesian Knowledge Tracing
function bktUpdate(p_known: number, correct: boolean,
p_T = 0.1, p_S = 0.1, p_G = 0.2) {
const p_obs = correct
? (p_known * (1 - p_S)) / (p_known * (1 - p_S) + (1 - p_known) * p_G)
: (p_known * p_S) / (p_known * p_S + (1 - p_known) * (1 - p_G));
return p_obs + (1 - p_obs) * p_T; // 매 mastery prob 의 update
}
function nextItem(skillStates, items) {
// 매 ZPD: mastery 0.4-0.7 의 item 의 prefer
return items
.map(i => ({ i, score: Math.abs(skillStates[i.skill] - 0.55) }))
.sort((a, b) => a.score - b.score)[0].i;
}
```
### AI tutor 의 Socratic prompt
```typescript
const tutorSystemPrompt = `You are a Socratic tutor. NEVER give the answer.
- Ask one guiding question at a time.
- If student is stuck, decompose the problem.
- Validate effort, gently correct misconceptions.
- Use student's prior turn to scaffold.
- After 3 unsuccessful hints, offer worked example, not answer.
Subject: ${subject}
Student grade: ${grade}
Misconceptions log: ${misconceptions.join(', ')}`;
const response = await anthropic.messages.create({
model: 'claude-opus-4-7',
system: tutorSystemPrompt,
messages: history,
max_tokens: 400,
});
```
### xAPI 의 statement emit
```typescript
async function emitXAPI(actor, verb, object, result) {
await fetch(`${LRS}/statements`, {
method: 'POST',
headers: {
'Content-Type': 'application/json',
'X-Experience-API-Version': '1.0.3',
'Authorization': `Basic ${LRS_AUTH}`,
},
body: JSON.stringify({
actor: { account: { homePage: APP, name: actor.id } },
verb: { id: `http://adlnet.gov/expapi/verbs/${verb}`, display: { 'en-US': verb } },
object: { id: `${APP}/activities/${object.id}` },
result: { score: { scaled: result.score }, completion: result.completed },
timestamp: new Date().toISOString(),
}),
});
}
```
### Open Badges 3.0 (verifiable credential)
```json
{
"@context": ["https://www.w3.org/ns/credentials/v2",
"https://purl.imsglobal.org/spec/ob/v3p0/context-3.0.3.json"],
"type": ["VerifiableCredential", "OpenBadgeCredential"],
"issuer": {"id": "did:web:acme.edu", "name": "Acme Academy"},
"issuanceDate": "2026-05-10T12:00:00Z",
"credentialSubject": {
"id": "did:example:learner123",
"type": ["AchievementSubject"],
"achievement": {
"id": "https://acme.edu/badges/python-mastery",
"name": "Python Mastery",
"criteria": {"narrative": "Complete 5 projects + final exam ≥80%"}
}
},
"proof": {"type": "Ed25519Signature2020", "...": "..."}
}
```
### Knowledge graph 의 skill prerequisite
```cypher
MATCH (target:Skill {name: 'Calculus I'})
-[:REQUIRES*1..]->(pre:Skill)
WITH collect(DISTINCT pre) AS prereqs, target
MATCH (learner:User {id: $userId})-[:MASTERED]->(s:Skill)
WITH prereqs, target, collect(s) AS mastered
RETURN target,
[p IN prereqs WHERE NOT p IN mastered] AS gap;
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| K-12 math/reading | Adaptive engine + AI tutor (Socratic) |
| Higher-ed CS | Project-based + auto-grader + AI TA |
| Corporate L&D | Skill graph + micro-credential + xAPI |
| Language learning | Conversational AI + spaced repetition |
| Niche bootcamp | Cohort + mentor + portfolio review |
**기본값**: AI tutor (Socratic) + adaptive engine + xAPI tracking + Open Badges credential.
## 🔗 Graph
- 부모: [[Education Technology]]
- 변형: [[LMS]]
- 응용: [[Adaptive Learning]]
## 🤖 LLM 활용
**언제**: Socratic tutor, content scaffolding generation, formative feedback.
**언제 X**: high-stakes summative grading 의 LLM 의 sole arbiter 의 X.
## ❌ 안티패턴
- **Engagement-only metric**: time-on-app maximization 의 learning outcome 무관.
- **AI 의 give answer**: tutor 의 cheating tool 의 변질.
- **No interoperability**: LTI/xAPI 의 ignore — institution 의 lock-in.
- **Privacy 무시**: FERPA/COPPA 의 minor 의 consent 의 fail.
- **Credential inflation**: badge 의 rigor 의 X — recognition 의 erode.
## 🧪 검증 / 중복
- Verified (HolonIQ Edtech Funding Report 2025, IMS Global LTI/Caliper specs, Open Badges 3.0).
- 신뢰도 B (industry trends 의 변동 빠름).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — LTI/BKT/AI-tutor/xAPI/Open-Badges patterns |
@@ -0,0 +1,166 @@
---
id: wiki-2026-0508-efficiency
title: Efficiency
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Performance Efficiency, Resource Efficiency, Cost Efficiency]
duplicate_of: none
source_trust_level: A
confidence_score: 0.88
verification_status: applied
tags: [performance, efficiency, optimization, sre, cost]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: prometheus
---
# Efficiency
## 매 한 줄
> **"매 useful output / resource consumed — 매 latency, throughput, $cost, watt 매 dimension 별 측정"**. 매 1972 Knuth "premature optimization" warning 후 신중함이 default, 매 2026 cloud cost + carbon footprint + energy efficiency 가 first-class metric.
## 매 핵심
### 매 Efficiency dimensions
- **Time**: latency p50/p95/p99, throughput RPS.
- **Space**: memory RSS, disk IOPS, network bytes.
- **Money**: $/request, $/MAU.
- **Energy**: watt/op, gCO2eq/request.
### 매 측정 → 개선 cycle
1. **Profile**: hotspot 의 identify (flamegraph).
2. **Hypothesize**: bottleneck 의 type (CPU? IO? Lock?).
3. **Optimize**: targeted change.
4. **Verify**: A/B with baseline, metric 의 statistical sig.
### 매 응용
1. API: cold-start 의 reduce.
2. ML inference: quantization, batching, KV cache.
3. CI: cache hit rate 의 maximize.
## 💻 패턴
### Latency histogram (Prometheus)
```python
from prometheus_client import Histogram
LATENCY = Histogram('http_request_duration_seconds', 'HTTP latency',
buckets=[0.005, 0.01, 0.025, 0.05, 0.1, 0.25, 0.5, 1, 2.5, 5])
@LATENCY.time()
def handle(req): ...
```
### Cost-per-request rollup
```sql
-- BigQuery
SELECT
service,
SUM(billable_seconds * cpu_cost_per_sec) AS compute_usd,
COUNT(*) AS requests,
SUM(billable_seconds * cpu_cost_per_sec) / COUNT(*) AS usd_per_req
FROM service_metrics
WHERE _PARTITIONDATE = CURRENT_DATE() - 1
GROUP BY service
ORDER BY usd_per_req DESC;
```
### CPU flamegraph (py-spy)
```bash
# 매 production-safe sampling profiler
py-spy record -o flame.svg -d 60 -p $(pgrep -f gunicorn)
py-spy top -p $(pgrep -f gunicorn)
```
### Memory profiling (memray)
```bash
memray run --live ./app.py
memray flamegraph output.bin -o memflame.html
```
### Async IO efficiency
```python
import asyncio, httpx
# BAD — sequential
async def fetch_seq(urls):
async with httpx.AsyncClient() as c:
return [await c.get(u) for u in urls]
# GOOD — concurrent
async def fetch_par(urls):
async with httpx.AsyncClient() as c:
return await asyncio.gather(*[c.get(u) for u in urls])
```
### Carbon-aware scheduling
```python
import httpx
async def carbon_intensity(region: str) -> float:
r = await httpx.AsyncClient().get(
f"https://api.electricitymaps.com/v3/carbon-intensity/latest?zone={region}",
headers={"auth-token": "TOKEN"})
return r.json()["carbonIntensity"] # gCO2eq/kWh
# 매 batch job 매 low-carbon window 의 schedule
async def maybe_run(region):
ci = await carbon_intensity(region)
if ci < 200: await run_batch()
else: await asyncio.sleep(900)
```
### LLM inference batching
```python
from vllm import LLM, SamplingParams
llm = LLM(model="meta-llama/Llama-3.3-70B-Instruct",
tensor_parallel_size=4,
max_num_seqs=256) # 매 batch 의 throughput
sp = SamplingParams(max_tokens=256)
outs = llm.generate(prompts, sp) # 매 single forward pass 로 batch
```
### Cache efficiency dashboard
```promql
# Prometheus query — cache hit ratio
sum(rate(cache_hits_total[5m])) /
(sum(rate(cache_hits_total[5m])) + sum(rate(cache_misses_total[5m])))
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Latency-critical (real-time) | tail-latency optimize, drop p99 outliers |
| Throughput (batch) | parallelism, vectorize |
| Cost 제약 | spot instance, autoscale, cache |
| Green ops | carbon-aware scheduling, region selection |
**기본값**: 매 profile-first, 매 measure both before/after, 매 single-dimension fixation 매 X.
## 🔗 Graph
- 부모: [[Site Reliability Engineering]]
- 변형: [[Latency]]
- 응용: [[Flame_Graphs]] · [[Profiling]]
- Adjacent: [[FinOps]] · [[Green Software]]
## 🤖 LLM 활용
**언제**: profile output → bottleneck classification, optimization 후보 ranking.
**언제 X**: 매 micro-benchmark 매 LLM 의 single-shot 평가 X — 매 측정 우선.
## ❌ 안티패턴
- **Premature optimization**: profile 없이 optimize.
- **Single-metric obsession**: latency 만 보고 cost 폭증.
- **Synthetic benchmark**: production traffic shape 무시.
- **No baseline**: 매 before 측정 없이 "fast" 주장.
## 🧪 검증 / 중복
- Verified (SRE Workbook ch.4, AWS Well-Architected Performance pillar).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — efficiency 4 dimension + measurement loop |
@@ -0,0 +1,165 @@
---
id: wiki-2026-0508-electron-v8-memory-cage
title: Electron V8 Memory Cage
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [V8 Sandbox, V8 Pointer Compression Cage, Electron Memory Limit]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [electron, v8, security, memory, sandbox]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: javascript
framework: electron
---
# Electron V8 Memory Cage
## 매 한 줄
> **"매 V8 의 4GB virtual address cage"**. 매 V8 의 pointer compression (32-bit offset within 4GB cage) 의 introduction 의 each isolate 의 4GB heap limit 의 hard cap 의 impose. 매 Electron 의 main + renderer + utility process 의 each 의 separate cage 의 hold. 매 2026 년 의 V8 의 sandbox 의 default-on 의 spectre/heap-corruption mitigation 의 standard.
## 매 핵심
### 매 cage 구조
- **4GB virtual region** per V8 isolate.
- **32-bit compressed pointer** (relative to cage base).
- **All heap allocations** must fit inside cage.
- **External buffer (ArrayBuffer backing)** can live outside (with sandbox checks).
### 매 Electron implication
- 매 main process: 매 4GB cap.
- 매 renderer process: 매 4GB cap each (per BrowserWindow).
- 매 utility process: 매 separate cage.
- 매 large data → utility process 또는 native module.
### 매 응용
1. Heavy LLM inference UI (chunk via utility process).
2. Video editor (native module for frame buffers).
3. Multi-window archive viewer (split heaps per window).
4. Out-of-process computation (worker_threads / utilityProcess).
## 💻 패턴
### Diagnose hitting cage limit
```javascript
const v8 = require('v8');
const stats = v8.getHeapStatistics();
console.log({
total_heap_size_mb: stats.total_heap_size / 1024 / 1024,
heap_size_limit_mb: stats.heap_size_limit / 1024 / 1024, // ~4GB
external_memory_mb: stats.external_memory / 1024 / 1024,
});
```
### utilityProcess for off-cage work (Electron 25+)
```javascript
const { utilityProcess } = require('electron');
const child = utilityProcess.fork(path.join(__dirname, 'heavy-worker.js'), [], {
serviceName: 'pdf-parser',
// own V8 cage, own 4GB
});
child.postMessage({ task: 'parse', path: '/big.pdf' });
child.on('message', (result) => { /* handle */ });
```
### worker_thread (lighter, but shares process limits)
```javascript
const { Worker } = require('worker_threads');
const worker = new Worker('./inference-worker.js', {
resourceLimits: { maxOldGenerationSizeMb: 3500 }
});
worker.postMessage({ tokens });
worker.on('message', (output) => { /* ... */ });
// NOTE: each worker has its own V8 cage
```
### Native addon for >4GB buffers
```cpp
// node-addon-api: allocate outside V8 heap
#include <napi.h>
Napi::Value AllocLargeBuffer(const Napi::CallbackInfo& info) {
size_t bytes = info[0].As<Napi::Number>().Int64Value();
void* ptr = malloc(bytes); // outside V8 cage
// wrap in ArrayBuffer with external backing store
return Napi::ArrayBuffer::New(info.Env(), ptr, bytes,
[](Napi::Env, void* data) { free(data); });
}
```
### Disable pointer compression (escape cage — NOT recommended)
```bash
# Only for dev / specific embedding; loses sandbox + perf
electron --js-flags="--no-pointer-compression" .
# Production: prefer process split
```
### Memory-aware streaming pattern
```javascript
// Don't load 3GB JSON into V8 — stream + chunk
const { pipeline } = require('stream/promises');
const fs = require('fs');
const { Transform } = require('stream');
await pipeline(
fs.createReadStream('big.ndjson'),
new Transform({
transform(chunk, _, cb) {
// process chunk — never accumulate full
cb();
}
}),
);
```
### Per-window heap monitor
```javascript
mainWindow.webContents.on('render-process-gone', (event, details) => {
if (details.reason === 'oom') {
log.error('Renderer OOM — likely cage exhausted');
relaunchWindow();
}
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| < 1GB working set | Single renderer, no special handling |
| 1-3GB | Monitor + GC pressure tuning |
| 3-4GB approaching | utilityProcess 분리 |
| > 4GB single dataset | Native addon + external buffer |
| Many concurrent heavy ops | Multiple utilityProcess (each 4GB) |
**기본값**: 매 utilityProcess 의 split — 매 sandbox + cage 의 multiplication.
## 🔗 Graph
- 부모: [[V8 Engine]] · [[Electron]]
- 변형: [[Chrome V8 Heap Analysis]]
- Adjacent: [[Pointer Compression]] · [[V8 Sandbox]] · [[Garbage Collection]]
## 🤖 LLM 활용
**언제**: 매 OOM crash diagnosis. 매 cage limit 의 explanation. 매 process-split refactor.
**언제 X**: 매 V8 internal flag 의 latest 는 V8 release notes 의 verify.
## ❌ 안티패턴
- **Bigger `--max-old-space-size` only**: 매 4GB cap 의 hit. 매 size 만 의 늘림 의 X.
- **Single-renderer 의 모든 work**: 매 cage 의 single 의 exhaust. 매 split.
- **External buffer 의 forget GC**: 매 native addon 의 finalizer 의 mandatory.
## 🧪 검증 / 중복
- Verified (V8 pointer compression docs, Electron process model docs, V8 sandbox RFC).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — V8 cage / Electron process split |
@@ -0,0 +1,225 @@
---
id: wiki-2026-0508-encapsulation-via-access-modifie
title: Encapsulation via Access Modifiers
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Access Modifiers, Visibility Modifiers, Encapsulation]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [oop, encapsulation, access-modifier, language-design]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: General
---
# Encapsulation via Access Modifiers
## 매 한 줄
> **"매 internal state 의 hide + boundary 의 explicit"**. 1967 Simula 의 OOP 의 도입 후 매 Bertrand Meyer 의 "Design by Contract", Parnas 의 information hiding 원칙 의 codify — 2026 modern lang 는 `public/private/protected` 의 보다, JS `#private`, Rust module visibility, TS `readonly`, Java `sealed`, C# `init`-only 의 fine-grained capability 의 dominate.
## 매 핵심
### 매 Access modifier 의 종류 (lang 별)
- **Java**: `public`, `protected`, package-private (default), `private`.
- **C#**: `public`, `protected`, `internal`, `private`, `protected internal`, `private protected`, `file`.
- **TypeScript**: `public` (default), `protected`, `private`, `#private` (true private — JS native).
- **Rust**: `pub`, `pub(crate)`, `pub(super)`, `pub(in path)`, default private to module.
- **Python**: convention only — `_underscore` (protected), `__double` (name-mangled).
- **Kotlin**: `public` (default), `internal` (module), `protected`, `private`.
### 매 Encapsulation 의 layer
- **Visibility**: who can see.
- **Mutability**: `final`, `readonly`, `const`, `val`.
- **Identity**: opaque type, newtype.
- **Invariant**: setter validation, factory.
### 매 응용
1. API 의 stable surface 의 maintain (semver).
2. Library author 의 internal refactoring freedom.
3. Test isolation (private — black-box test 의 강제).
4. Security boundary (capability 의 leak 방지).
## 💻 패턴
### TypeScript 의 `#private` (true private)
```typescript
class BankAccount {
#balance = 0; // 매 runtime 의 private — TS `private` 의 erase 의 X
readonly id: string;
constructor(id: string) { this.id = id; }
deposit(amount: number) {
if (amount <= 0) throw new Error('positive only');
this.#balance += amount;
}
get balance() { return this.#balance; }
}
const a = new BankAccount('A1');
// a.#balance = 999; // SyntaxError 의 compile + runtime
```
### Rust 의 module visibility
```rust
mod auth {
pub struct User {
pub name: String,
password_hash: String, // 매 module 외부 의 invisible
}
impl User {
pub fn new(name: &str, pw: &str) -> Self {
User { name: name.into(), password_hash: hash(pw) }
}
pub(crate) fn verify(&self, pw: &str) -> bool {
self.password_hash == hash(pw)
}
}
fn hash(s: &str) -> String { /* ... */ s.into() }
}
```
### Java sealed + record
```java
public sealed interface Shape permits Circle, Square, Triangle {}
public record Circle(double radius) implements Shape {
public Circle { // 매 compact constructor 의 invariant
if (radius < 0) throw new IllegalArgumentException();
}
}
// 매 exhaustive switch 의 enable
String describe(Shape s) {
return switch (s) {
case Circle c -> "circle r=" + c.radius();
case Square sq -> "square";
case Triangle t -> "tri";
};
}
```
### C# init-only + required
```csharp
public class Order
{
public required string Id { get; init; } // 매 set 의 only at init
public DateTime Created { get; init; } = DateTime.UtcNow;
private decimal _total;
public decimal Total
{
get => _total;
private set => _total = value >= 0 ? value :
throw new ArgumentException();
}
}
var o = new Order { Id = "ORD-1" }; // 매 valid
// o.Id = "X"; // 매 error: init-only
```
### Python 의 convention + property
```python
class Vault:
def __init__(self, secret):
self._secret = secret # 매 protected (convention)
self.__truly_hidden = "obfuscated" # 매 _Vault__truly_hidden
@property
def secret(self):
# 매 read-only 의 access
return f"***{self._secret[-2:]}"
v = Vault("p@ssword")
print(v.secret) # ***rd
# v.secret = "x" # AttributeError
```
### Capability-based design (no class)
```typescript
// 매 closure-based 의 information hiding
function makeCounter() {
let count = 0;
return {
inc: () => ++count,
get: () => count,
// 매 reset 의 reveal 안 하면 의 capability 의 absent
};
}
const c = makeCounter();
c.inc(); c.inc();
console.log(c.get()); // 2 — count 의 access 의 X
```
### Friend / internal API (Kotlin)
```kotlin
// 매 internal 의 same module 만의 access
internal class IndexBuilder {
internal fun rebuild() { /* ... */ }
}
// 매 @PublishedApi 의 inline function 의 internal API 의 publish
@PublishedApi
internal fun secretImpl() = 42
inline fun publicWrapper() = secretImpl()
```
### Newtype 의 opaque ID
```rust
pub struct UserId(u64); // 매 tuple struct 의 inner 의 private
impl UserId {
pub fn new(id: u64) -> Self { UserId(id) }
pub fn value(&self) -> u64 { self.0 }
}
// 매 raw u64 의 mistakenly UserId 로 의 X — type-safe boundary
fn get_user(id: UserId) { /* ... */ }
// get_user(123); // compile error
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Library API | `pub` 의 minimal surface, internal 의 default |
| Domain model | private field + factory + invariant |
| DTO/value | `record` / `data class` / immutable |
| JS/TS browser code | `#private` (true private) 의 default |
| Cross-module refactoring | `internal`/`pub(crate)` 의 prefer |
**기본값**: most restrictive 의 default. 매 explicit 하 expand.
## 🔗 Graph
- 부모: [[Object-Oriented Programming (OOP)]] · [[Information Hiding]]
- 변형: [[Module System]]
- 응용: [[API Design]] · [[Library Design]] · [[Refactoring_Best_Practices|Refactoring]]
- Adjacent: [[Abstraction]] · [[SOLID]]
## 🤖 LLM 활용
**언제**: API surface review, accessor pattern 의 generate, visibility audit.
**언제 X**: language-specific subtle case (Kotlin internal mangling 등) 의 verify 필수.
## ❌ 안티패턴
- **Public field**: encapsulation 의 broken — invariant 의 enforce 의 X.
- **Getter/setter for everything**: encapsulation 의 illusion (Tell Don't Ask 위반).
- **Reflection 의 private 의 bypass**: test 의 implementation 의 lock.
- **Java private 의 inner class**: enclosing class 의 implicit access — confusion.
- **TS `private` 의 trust**: runtime 의 erase — `#private` 사용.
## 🧪 검증 / 중복
- Verified (Bloch "Effective Java" Item 15, Parnas 1972 "Decomposition", JLS, ECMA-262).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — TS/Rust/Java/C#/Kotlin/Python access patterns |
@@ -0,0 +1,154 @@
---
id: wiki-2026-0508-engineering-metrics-dora
title: Engineering Metrics (DORA)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [DORA, DORA Metrics, Four Keys, DevOps Research and Assessment]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [devops, metrics, dora, sre, engineering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: yaml
framework: github-actions
---
# Engineering Metrics (DORA)
## 매 한 줄
> **"매 deployment frequency, lead time, change fail rate, MTTR — 4 metric 으로 매 engineering org 의 health 측정"**. 매 2014 Google DORA team 의 launch, 매 2021 SPACE framework 보완, 매 2026 GitHub/GitLab/Datadog 의 native dashboard 의 default.
## 매 핵심
### 매 Four Keys
- **Deployment Frequency (DF)**: 매 production deploy 의 빈도. Elite = on-demand (multiple/day).
- **Lead Time for Changes (LT)**: 매 commit → production. Elite = < 1 day.
- **Change Failure Rate (CFR)**: 매 deploy 의 incident 유발 비율. Elite = 0–15%.
- **Mean Time to Recovery (MTTR)**: 매 incident → restore. Elite = < 1 hour.
### 매 Performance tier
- **Elite**: DF on-demand · LT < 1day · CFR 0–15% · MTTR < 1h.
- **High**: DF weekly–daily · LT 1day–1wk · CFR 16–30% · MTTR < 1day.
- **Medium**: DF monthly · LT 1wk–1mo · CFR 16–30% · MTTR 1day–1wk.
- **Low**: DF < monthly · LT > 1mo.
### 매 응용
1. Sprint retro 매 주 review.
2. Quarterly engineering OKR target.
3. Hiring/promo signal (team-level, 매 individual 아님).
## 💻 패턴
### GitHub Actions deployment frequency
```yaml
# .github/workflows/deploy.yml
name: deploy
on:
push:
branches: [main]
jobs:
deploy:
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
- run: ./deploy.sh
- name: Emit DORA event
run: |
curl -X POST https://api.dora-collector.internal/events \
-H "Authorization: Bearer ${{ secrets.DORA_TOKEN }}" \
-d '{"type":"deploy","sha":"${{ github.sha }}","ts":"'$(date -u +%FT%TZ)'"}'
```
### Lead time calculation (SQL)
```sql
-- commits joined with deploys
SELECT
PERCENTILE_CONT(0.5) WITHIN GROUP (ORDER BY EXTRACT(EPOCH FROM (deploy_ts - commit_ts))/3600) AS p50_hours,
PERCENTILE_CONT(0.95) WITHIN GROUP (ORDER BY EXTRACT(EPOCH FROM (deploy_ts - commit_ts))/3600) AS p95_hours
FROM dora_events
WHERE deploy_ts >= NOW() - INTERVAL '30 days';
```
### Change failure rate from incidents
```python
# rolling 30d CFR
def cfr(deploys: list[dict], incidents: list[dict]) -> float:
bad_deploys = {i["deploy_sha"] for i in incidents if i["caused_by_deploy"]}
return len(bad_deploys) / max(len(deploys), 1)
```
### MTTR via PagerDuty
```python
import httpx, statistics
def mttr(api_key: str, since: str) -> float:
r = httpx.get("https://api.pagerduty.com/incidents",
headers={"Authorization": f"Token token={api_key}"},
params={"since": since, "statuses[]": "resolved"})
durations = [(i["resolved_at_ts"] - i["created_at_ts"]) for i in r.json()["incidents"]]
return statistics.median(durations) / 60 # minutes
```
### Four Keys dashboard (Datadog)
```yaml
# datadog-dora.yaml
widgets:
- title: Deployment Frequency
query: "sum:dora.deploy{*}.as_count().rollup(sum, 86400)"
- title: Lead Time p50
query: "p50:dora.lead_time_seconds{*}"
- title: CFR
query: "sum:dora.deploy_failed{*} / sum:dora.deploy{*}"
- title: MTTR p50
query: "p50:dora.incident_resolve_seconds{*}"
```
### Trunk-based config (lead time 단축)
```yaml
# .github/branch-protection.yml
required_status_checks:
strict: true
contexts: [ci/test, ci/lint]
required_pull_request_reviews:
required_approving_review_count: 1
dismiss_stale_reviews: true
restrictions: null # 매 직접 push 매 X — PR-only
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Startup (<20 eng) | DF + LT 매 우선, MTTR 매 secondary |
| Regulated industry | CFR 매 primary (release safety) |
| Platform team | All 4, 매 weekly review |
| Individual perf review | 매 X — team metric only |
**기본값**: 매 four-keys-platform (Google open source) self-host + Grafana.
## 🔗 Graph
- 부모: [[DevOps]] · [[Site Reliability Engineering]]
- 응용: [[Continuous Delivery]] · [[Continuous Integration]]
## 🤖 LLM 활용
**언제**: deploy log → metric extraction, incident root-cause 분류 (deploy 유발 여부).
**언제 X**: 매 individual contributor scoring 매 X — DORA 매 team-level only.
## ❌ 안티패턴
- **Goodharting**: DF 만 chase 하고 quality 무시 → CFR 폭증.
- **Individual scoring**: developer 별 LT 측정 → gaming (small commits 만).
- **Vanity rollups**: org-wide average — 팀 distribution 의 hide.
- **No CFR**: deploy 만 count, failure track X → false elite signal.
## 🧪 검증 / 중복
- Verified (DORA "State of DevOps" 2014–2024 reports, Google Cloud 공식).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — DORA four-keys 정의 + dashboard pattern |
@@ -0,0 +1,158 @@
---
id: wiki-2026-0508-ensuring-data-privacy
title: Ensuring Data Privacy
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Data Privacy, Privacy Engineering, GDPR Compliance]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [privacy, gdpr, security, compliance]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Python/TypeScript
framework: OneTrust/Fides/OPA
---
# Ensuring Data Privacy
## 매 한 줄
> **"매 personal data 가 lawful basis + minimum + purpose-limited 로 다뤄진다."**. Data privacy engineering 은 매 GDPR/CCPA/LGPD/K-PIPA 의 legal requirement 를 매 storage, processing, transfer, retention 의 매 단계 에 deterministic control 로 구현. 2026 stack: classification + DLP + tokenization/PETs (DP, FHE, TEE) + consent management + DSAR automation + privacy-by-design.
## 매 핵심
### 매 Privacy Principle (GDPR Art.5)
1. **Lawfulness, fairness, transparency** — consent / legitimate interest.
2. **Purpose limitation** — 매 collected purpose 외 사용 금지.
3. **Data minimization** — 매 필요한 최소.
4. **Accuracy** — correctable.
5. **Storage limitation** — retention schedule.
6. **Integrity & confidentiality** — encryption.
7. **Accountability** — DPO, audit, DPIA.
### 매 PET (Privacy-Enhancing Tech) 2026
- **Pseudonymization**: tokenization, format-preserving encryption (FPE).
- **Anonymization**: k-anonymity, l-diversity, t-closeness.
- **Differential Privacy**: ε,δ noise — Apple, US Census, Chrome.
- **Federated learning**: 매 model travels, data stays.
- **Homomorphic encryption (FHE)**: 매 compute on encrypted — Microsoft SEAL, OpenFHE.
- **Confidential computing (TEE)**: Intel TDX, AMD SEV-SNP, Apple Private Cloud Compute.
- **Zero-Knowledge Proofs**: identity 증명 without disclose.
### 매 응용
1. EU GDPR + 한국 PIPA + 중국 PIPL compliance.
2. Healthcare HIPAA, PCI-DSS payment.
3. ML training without raw data (FL, DP).
4. Cross-border transfer (SCC, BCR, DPF).
5. Right to be forgotten (RTBF) automation.
## 💻 패턴
### Data classification + DLP
```python
# 매 PII detection — Microsoft Presidio
from presidio_analyzer import AnalyzerEngine
analyzer = AnalyzerEngine()
results = analyzer.analyze(text=user_input, language='en',
entities=['EMAIL_ADDRESS','PHONE_NUMBER','CREDIT_CARD','PERSON','KR_RRN'])
for r in results: redact_or_mask(text, r.start, r.end)
```
### Format-preserving tokenization
```python
# 매 ff3-1 — preserves format (e.g., card number)
from ff3 import FF3Cipher
c = FF3Cipher(key, tweak)
token = c.encrypt("4242424242424242") # → 16-digit string
plain = c.decrypt(token)
```
### Differential Privacy noise
```python
import numpy as np
def laplace_mechanism(true_val, sensitivity, epsilon):
return true_val + np.random.laplace(0, sensitivity / epsilon)
# 매 query: count of users in segment
noisy_count = laplace_mechanism(true_count=1234, sensitivity=1, epsilon=1.0)
```
### k-anonymity check
```python
import pandas as pd
def k_anonymity(df: pd.DataFrame, quasi_ids: list[str]) -> int:
return df.groupby(quasi_ids).size().min()
# 매 ensure k>=5 before release
assert k_anonymity(df, ['zip','age','gender']) >= 5
```
### DSAR (Data Subject Access Request) automation
```python
async def dsar_export(user_id: str) -> bytes:
bundle = {
'profile': await db.users.find_one({'_id':user_id}),
'orders': [o async for o in db.orders.find({'userId':user_id})],
'logs': await elasticsearch_export(user_id),
}
return json.dumps(bundle, default=str).encode()
async def dsar_erasure(user_id: str):
await db.users.update_one({'_id':user_id},
{'$set': {'email':None,'name':None,'erasedAt':datetime.utcnow()}})
await s3.delete_objects(Bucket='pii', Prefix=f'users/{user_id}/')
```
### Consent record (Fides/IAB TCF)
```typescript
const consent = {
userId: 'u_123',
purposes: { analytics: true, marketing: false, personalization: true },
vendors: { google: true },
timestamp: new Date().toISOString(),
version: 'tcf-2.2',
signature: hmac(record),
};
await db.consents.insertOne(consent);
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| EU users | GDPR + Schrems II SCC |
| 한국 users | PIPA — 개인정보처리방침, 위탁 동의 |
| Aggregate analytics | Differential Privacy |
| Payment data | PCI-DSS tokenization |
| ML training | Federated learning + DP |
| Cross-org compute | TEE (Confidential Computing) |
**기본값**: 매 minimize + classify + tokenize + consent ledger + DSAR API.
## 🔗 Graph
- 부모: [[Practical-Cryptography]] · [[보안 및 시스템 신뢰성 표준|Symmetric-Encryption]]
- 변형: [[보안 및 시스템 신뢰성 표준|Zero-Trust Architecture]]
- 응용: [[Anomaly-Detection]] · [[Information-Society]]
- Adjacent: [[Digital Intellectual Property Rights]]
## 🤖 LLM 활용
**언제**: privacy policy 검토, DSAR response draft, PIA 질문 generation.
**언제 X**: 매 PII 를 third-party LLM 에 raw 로 전송 — anonymize 먼저.
## ❌ 안티패턴
- **Hash = anonymized 오해**: 매 hash 는 pseudonymization, GDPR 적용.
- **Consent on entry-only**: 매 ongoing — withdrawable, granular.
- **Log PII**: 매 logger 가 leak source — redact filter.
- **Forever retention**: 매 GDPR 위반 — TTL + erasure.
- **Plaintext backup**: 매 encryption at rest 필수.
## 🧪 검증 / 중복
- Verified: GDPR Art.5/17/25; ISO/IEC 27701; NIST SP 800-188; Microsoft Presidio docs.
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — principles + PETs + DSAR/DP patterns |
@@ -0,0 +1,202 @@
---
id: wiki-2026-0508-enterprise-scale-monorepo-manage
title: Enterprise Scale Monorepo Management
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Monorepo, Polyrepo vs Monorepo, Bazel, Nx, Turborepo]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [monorepo, build-system, devops, ci-cd, scaling]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: nx-turborepo-bazel
---
# Enterprise Scale Monorepo Management
## 매 한 줄
> **"매 single repo, many projects — 매 build graph 의 일관성"**. 매 monorepo 의 핵심은 모든 코드를 하나의 VCS root 안에 두되, 매 build 시스템이 dependency graph 를 이해해서 affected projects 만 build/test 한다는 점. Google (Piper/Bazel), Meta (Buck2), Microsoft (Rush), 그리고 매 OSS 의 Nx/Turborepo 가 이 패러다임을 driving.
## 매 핵심
### 매 Monorepo 가치
- **Atomic cross-project changes**: 매 API + caller 의 한 PR 안에서 변경.
- **Shared tooling**: 매 lint, format, build, test 의 unified config.
- **Visibility**: 매 모든 코드 의 grep-able.
- **Refactor confidence**: 매 type-checker 가 모든 caller 를 검증.
### 매 도전 과제
- **Build time scaling**: 매 naive build 의 N² growth — affected detection 필수.
- **VCS performance**: 매 git 의 100GB+ repo 에서 sparse checkout / VFS 필요.
- **Permissions**: 매 single repo + multiple teams = CODEOWNERS / branch protection.
- **CI cost**: 매 모든 commit 의 모든 project rebuild 의 X — incremental + cache.
### 매 도구 선택
1. **Nx** (TypeScript-heavy, mid-large): smart caching + computation graph.
2. **Turborepo** (Vercel, JS/TS): Rust-based, simple config, remote cache.
3. **Bazel** (polyglot, mega-scale): hermetic builds, network-distributed.
4. **Pants** (Python-heavy): similar to Bazel, lighter setup.
5. **Rush** (.NET / TS): Microsoft's pnpm-based.
## 💻 패턴
### Nx workspace structure
```bash
my-org/
├── nx.json
├── package.json
├── tsconfig.base.json
├── apps/
│ ├── web/ # Next.js app
│ └── api/ # NestJS API
├── libs/
│ ├── ui/ # shared React components
│ ├── data-access/# API clients
│ └── utils/
└── tools/
```
### nx.json with affected + cache
```json
{
"tasksRunnerOptions": {
"default": {
"runner": "nx-cloud",
"options": {
"cacheableOperations": ["build", "test", "lint", "e2e"],
"accessToken": "${NX_CLOUD_TOKEN}"
}
}
},
"targetDefaults": {
"build": { "dependsOn": ["^build"], "inputs": ["production", "^production"] },
"test": { "inputs": ["default", "^production", "{workspaceRoot}/jest.preset.js"] }
},
"namedInputs": {
"default": ["{projectRoot}/**/*", "sharedGlobals"],
"production": ["default", "!{projectRoot}/**/*.spec.ts", "!{projectRoot}/jest.config.ts"]
}
}
```
### Affected detection in CI
```yaml
# .github/workflows/ci.yml
jobs:
affected:
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
with: { fetch-depth: 0 }
- uses: nrwl/nx-set-shas@v4
- run: pnpm install --frozen-lockfile
- run: npx nx affected -t lint test build --parallel=4
- run: npx nx affected -t e2e --parallel=1
```
### Turborepo pipeline
```json
// turbo.json
{
"$schema": "https://turbo.build/schema.json",
"globalDependencies": ["**/.env.*local"],
"tasks": {
"build": {
"dependsOn": ["^build"],
"outputs": [".next/**", "!.next/cache/**", "dist/**"]
},
"test": { "dependsOn": ["build"], "outputs": ["coverage/**"] },
"lint": {},
"dev": { "cache": false, "persistent": true }
}
}
```
### Bazel BUILD file (polyglot)
```python
# libs/ui/BUILD.bazel
load("@npm//:defs.bzl", "npm_link_all_packages")
load("@aspect_rules_ts//ts:defs.bzl", "ts_project")
ts_project(
name = "ui",
srcs = glob(["src/**/*.ts", "src/**/*.tsx"]),
declaration = True,
tsconfig = "//:tsconfig",
deps = [
"//libs/utils",
"@npm//react",
"@npm//@types/react",
],
visibility = ["//apps:__subpackages__"],
)
```
### CODEOWNERS for team boundaries
```
# CODEOWNERS
/apps/web/ @org/frontend-team
/apps/api/ @org/backend-team
/libs/ui/ @org/design-system
/libs/data-access/ @org/backend-team @org/frontend-team
/.github/ @org/platform-team
/tools/ @org/platform-team
```
### Remote cache with Turborepo
```bash
# Self-hosted with turborepo-remote-cache
docker run -p 3000:3000 \
-e TURBO_TOKEN=secret \
-e STORAGE_PROVIDER=s3 \
-e STORAGE_PATH=my-bucket \
ducktors/turborepo-remote-cache
# In repo:
echo 'TURBO_API=http://cache.internal:3000' > .turbo/config.json
echo 'TURBO_TOKEN=secret' >> .turbo/config.json
turbo build --remote-only
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| <50 packages, JS/TS only | Turborepo (simplicity) |
| 50-500 packages, type-heavy | Nx (project graph + generators) |
| Polyglot (Go+Rust+TS+Python) | Bazel (hermeticity) |
| Python ML monorepo | Pants v2 |
| <10 packages | pnpm workspaces alone |
**기본값**: 매 TS/JS team 에게 Turborepo 또는 Nx (size dependent).
## 🔗 Graph
- 부모: [[Version Control]]
- 응용: [[Code Ownership]]
- Adjacent: [[Bazel]] · [[Nx]] · [[Turborepo]]
## 🤖 LLM 활용
**언제**: refactoring across packages, generating new lib boilerplate (Nx generator), CODEOWNERS automation, dependency graph 분석.
**언제 X**: 매 build cache invalidation logic 의 직접 결정 — Nx/Bazel hash algorithm 신뢰.
## ❌ 안티패턴
- **Single CI job for entire repo**: 매 affected detection 없이 매 commit 모든 build — 30분+ pipeline.
- **No remote cache**: 매 each developer 가 cold rebuild — wasteful.
- **Mixing app-specific and lib code**: 매 libs/ 와 apps/ 의 분리 안 함 — circular deps risk.
- **Implicit dependencies**: 매 package.json 에 list 안 된 import — Bazel/Nx 가 catch.
- **No CODEOWNERS**: 매 review fatigue + ownership 모호.
## 🧪 검증 / 중복
- Verified (Nx Cloud docs 2026, Turborepo 2.0, Bazel 7).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — monorepo tooling matrix + Nx/Turbo/Bazel patterns |
@@ -0,0 +1,149 @@
---
id: wiki-2026-0508-feature-flags
title: Feature Flags
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Feature Toggles, Feature Switches, Feature Gates]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [devops, deployment, experimentation, release-engineering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript/Go
framework: LaunchDarkly/Unleash/OpenFeature
---
# Feature Flags
## 매 한 줄
> **"매 deploy 와 release 를 매 분리하는 runtime conditional"**. Pete Hodgson 의 매 4-axis taxonomy (release/experiment/ops/permission) 가 매 baseline. 매 modern stack — OpenFeature spec + provider (LaunchDarkly, Unleash, ConfigCat, Statsig) — 매 progressive delivery, A/B test, kill switch 의 매 통합 layer.
## 매 핵심
### 매 4 종류 (Hodgson)
- **Release toggle**: dark launch, gradual rollout (short-lived).
- **Experiment toggle**: A/B/n test (medium-lived).
- **Ops toggle**: kill switch, circuit breaker (medium-lived).
- **Permission toggle**: per-user/tenant entitlement (long-lived).
### 매 axis
- Lifetime: hours ↔ years.
- Dynamism: build-time → runtime → request-time.
- Scope: global → user → request.
### 매 응용
1. Trunk-based development + dark launch.
2. Canary / progressive rollout (1% → 100%).
3. Kill switch (incident mitigation).
4. A/B testing & holdout group.
5. Tier-based feature gating (free/pro/enterprise).
## 💻 패턴
### OpenFeature SDK (vendor-neutral)
```typescript
import { OpenFeature } from '@openfeature/server-sdk';
import { LaunchDarklyProvider } from '@openfeature/launchdarkly-server-provider';
await OpenFeature.setProviderAndWait(new LaunchDarklyProvider(SDK_KEY));
const client = OpenFeature.getClient();
const showNew = await client.getBooleanValue('new-checkout', false, {
targetingKey: user.id,
email: user.email,
plan: user.plan,
});
return showNew ? renderNewCheckout() : renderOldCheckout();
```
### Percentage rollout (deterministic hash)
```go
import "hash/fnv"
func rollout(flagKey, userID string, percent int) bool {
h := fnv.New32a()
h.Write([]byte(flagKey + ":" + userID))
return int(h.Sum32()%100) < percent
}
// Same user → same bucket across calls (sticky).
```
### Kill switch (ops toggle)
```typescript
async function fetchRecommendations(userId: string) {
if (await flags.getBooleanValue('reco-kill-switch', false)) {
return []; // disable the feature instantly during incident
}
return recoService.fetch(userId);
}
```
### Multivariate experiment
```typescript
const variant = await client.getStringValue('checkout-variant', 'control', ctx);
switch (variant) {
case 'one-click': return <OneClickCheckout />;
case 'wallet': return <WalletCheckout />;
default: return <StandardCheckout />;
}
metrics.track('checkout_view', { variant, userId });
```
### Local override (dev/test)
```typescript
if (process.env.NODE_ENV === 'development') {
OpenFeature.setProvider(new InMemoryProvider({
'new-checkout': { defaultVariant: 'on', variants: { on: true, off: false } },
}));
}
```
### Flag cleanup (technical debt)
```bash
# Find old flags
rg "getBooleanValue\\('old-checkout'" --type ts
# Provider audit: list flags > 90 days old, no recent eval, 100% rollout → delete.
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Dark launch / gradual | Release toggle, percentage rollout |
| Hypothesis test | Experiment toggle + analytics |
| Incident mitigation | Ops toggle (always available) |
| Tier / paid features | Permission toggle (long-lived) |
| Build-time only | Compile flag (no runtime cost) |
**기본값**: OpenFeature SDK + managed provider (LaunchDarkly/Unleash). Kill switch 모든 critical path 에 매.
## 🔗 Graph
- 부모: [[Continuous Delivery]] · [[Progressive Delivery]]
- 변형: [[Kill Switch]]
- 응용: [[Trunk-based Development]]
- Adjacent: [[LaunchDarkly]] · [[Unleash]]
## 🤖 LLM 활용
**언제**: Release strategy 설계, incident playbook, experiment platform 평가.
**언제 X**: Static config — env var / config file 충분.
## ❌ 안티패턴
- **Flag debt**: 100% rolled-out flag 를 매 안 지움 → cyclomatic complexity 폭발.
- **Nested flags**: A&&B&&C — 매 test space 매 explosion.
- **Flag in hot loop**: per-request eval 의 매 latency — cache locally.
- **No fallback**: provider 다운 시 feature 깨짐 — default + cached value.
- **Flag = config 오용**: 진짜 config 는 매 config service 로.
- **No analytics linkage**: experiment 인데 evaluation 안 records.
## 🧪 검증 / 중복
- Verified (martinfowler.com Feature Toggles, OpenFeature spec, LaunchDarkly docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — 4-axis taxonomy + OpenFeature/percentage/kill-switch 패턴 |
@@ -0,0 +1,183 @@
---
id: wiki-2026-0508-figma-to-code-workflow
title: Figma to Code Workflow
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Figma to React, Design to Code, Design Token Pipeline]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [figma, design-system, tokens, react, workflow]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: react
---
# Figma to Code Workflow
## 매 한 줄
> **"매 design token 을 single source of truth — 매 Figma Variables → JSON → CSS/TS 의 자동 sync"**. 매 2023 Figma Variables launch 후 표준화, 매 2026 Figma Code Connect + Style Dictionary + LLM-assisted MCP server 가 default workflow.
## 매 핵심
### 매 Pipeline 단계
1. **Design**: Figma Variables (color, spacing, typography).
2. **Export**: Figma API or Tokens Studio plugin → JSON.
3. **Transform**: Style Dictionary → CSS vars + TS types.
4. **Consume**: components import tokens, 매 hardcode X.
### 매 Component sync 방식
- **Code Connect**: Figma component ↔ React component pin.
- **Storybook**: Figma plugin 의 design ↔ story link.
- **Visual regression**: Chromatic — 매 token diff 의 detection.
### 매 응용
1. Multi-brand theming: tokens swap → 매 component 의 unchanged.
2. Dark mode: light/dark variable mode toggle.
3. A11y: contrast token 자동 검증.
## 💻 패턴
### Figma Variables export (REST)
```ts
// scripts/fetch-figma-tokens.ts
import { writeFileSync } from 'node:fs';
const FILE_KEY = process.env.FIGMA_FILE_KEY!;
const TOKEN = process.env.FIGMA_TOKEN!;
const r = await fetch(
`https://api.figma.com/v1/files/${FILE_KEY}/variables/local`,
{ headers: { 'X-Figma-Token': TOKEN } }
);
const { meta } = await r.json();
writeFileSync('tokens/figma.json', JSON.stringify(meta, null, 2));
```
### Style Dictionary config
```js
// style-dictionary.config.js
module.exports = {
source: ['tokens/**/*.json'],
platforms: {
css: {
transformGroup: 'css',
buildPath: 'src/styles/',
files: [{ destination: 'tokens.css', format: 'css/variables' }]
},
ts: {
transformGroup: 'js',
buildPath: 'src/tokens/',
files: [{
destination: 'index.ts',
format: 'javascript/es6',
options: { outputReferences: true }
}]
}
}
};
```
### Tailwind config consuming tokens
```ts
// tailwind.config.ts
import tokens from './src/tokens';
export default {
theme: {
extend: {
colors: tokens.color,
spacing: tokens.spacing,
fontSize: tokens.font.size
}
}
};
```
### Figma Code Connect (React)
```tsx
// Button.figma.tsx
import figma from '@figma/code-connect';
import { Button } from './Button';
figma.connect(Button, 'https://figma.com/file/X/?node-id=1:23', {
props: {
variant: figma.enum('Variant', { Primary: 'primary', Ghost: 'ghost' }),
size: figma.enum('Size', { Small: 'sm', Medium: 'md', Large: 'lg' }),
label: figma.textContent('Label')
},
example: ({ variant, size, label }) => (
<Button variant={variant} size={size}>{label}</Button>
)
});
```
### MCP server (Claude/Cursor 의 Figma read)
```json
// .mcp.json
{
"mcpServers": {
"figma": {
"command": "npx",
"args": ["@figma/mcp-server", "--file", "FILE_KEY"],
"env": { "FIGMA_TOKEN": "${FIGMA_TOKEN}" }
}
}
}
```
### CI: token drift detection
```yaml
# .github/workflows/tokens.yml
on: { schedule: [{ cron: '0 9 * * 1-5' }] }
jobs:
sync:
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
- run: pnpm i && pnpm tsx scripts/fetch-figma-tokens.ts
- run: pnpm style-dictionary build
- uses: peter-evans/create-pull-request@v6
with:
title: 'chore: sync Figma tokens'
branch: tokens/auto-sync
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Single brand, small | CSS vars manual export |
| Multi-brand or theming | Style Dictionary + modes |
| Tight design↔code coupling | Code Connect + Storybook |
| LLM-assisted dev | Figma MCP server |
**기본값**: Figma Variables → Style Dictionary → Tailwind/CSS vars + Code Connect.
## 🔗 Graph
- 부모: [[Design System]] · [[Large_Frontend_Projects|Frontend Architecture]]
- 변형: [[Design Tokens]]
- 응용: [[Storybook]] · [[Component Library]]
- Adjacent: [[CSS_Architecture_and_Styling|Tailwind CSS]] · [[Visual Regression]]
## 🤖 LLM 활용
**언제**: Figma MCP → component spec → React scaffold (props, variants 자동).
**언제 X**: 매 pixel-perfect layout 매 manual hand-off 의 X — LLM 매 약함.
## ❌ 안티패턴
- **Hardcoded hex**: `color: #FF6B6B` 매 component 안에 — token swap 매 불가.
- **One-way sync**: code → Figma 의 reverse 무시 → drift.
- **No transform layer**: Figma JSON 매 직접 import — 매 platform-specific 변환 X.
- **Ignoring modes**: light/dark 매 separate file → maintenance hell.
## 🧪 검증 / 중복
- Verified (Figma Variables docs, Style Dictionary 4.x, Code Connect 1.x).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Figma → Style Dictionary → React pipeline |
@@ -0,0 +1,157 @@
---
id: wiki-2026-0508-figma
title: Figma
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Figma Design, FigJam, Dev Mode]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [design, design-tool, collaboration, design-system]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: Figma-Plugin-API/REST-API
---
# Figma
## 매 한 줄
> **"매 browser-native, multiplayer, vector design tool 의 매 default standard"**. Field & Wallace 2012 시작 — CRDT-based multiplayer + WebGL canvas + plugin ecosystem 으로 매 Sketch/XD 를 매 시장에서 displace. 매 2025 Adobe 인수 무산 후 independent, AI 기능 (Make Designs, Visual Search) 추가, Dev Mode 가 매 디자인-코드 핸드오프 표준.
## 매 핵심
### 매 architecture
- WebGL canvas (GPU-accelerated vector rendering).
- Multiplayer via OT/CRDT — sub-100ms cursor sync.
- File = node tree (Document → Page → Frame → ...).
- Component / variant / variable system.
### 매 핵심 primitive
- **Frame**: layout container (auto-layout = flexbox-like).
- **Component / Instance**: reusable + override.
- **Variable**: design token (color, number, string, boolean) — mode 별 (light/dark).
- **Style**: deprecated 추세, variable 로 대체.
### 매 응용
1. Design system 운영 (component library, token).
2. Prototyping (interactive flow).
3. Dev handoff (Dev Mode + code generation).
4. Whiteboard / brainstorming (FigJam).
## 💻 패턴
### Plugin: rename selection
```typescript
// manifest.json: { "main": "code.ts", "ui": "ui.html", "editorType": ["figma"] }
figma.showUI(__html__, { width: 240, height: 120 });
figma.ui.onmessage = (msg: { type: string; prefix: string }) => {
if (msg.type === 'rename') {
for (const node of figma.currentPage.selection) {
node.name = `${msg.prefix}_${node.name}`;
}
figma.notify(`Renamed ${figma.currentPage.selection.length}`);
}
};
```
### Variable mode swap (dark mode)
```typescript
const collection = figma.variables.getLocalVariableCollections()
.find(c => c.name === 'Theme')!;
const darkModeId = collection.modes.find(m => m.name === 'Dark')!.modeId;
figma.currentPage.setExplicitVariableModeForCollection(collection, darkModeId);
```
### REST API: export frames as PNG
```typescript
const FILE = 'abc123', TOKEN = process.env.FIGMA_TOKEN!;
const r = await fetch(`https://api.figma.com/v1/files/${FILE}`, {
headers: { 'X-Figma-Token': TOKEN }
});
const file = await r.json();
const frameIds = file.document.children.flatMap(p =>
p.children.filter(n => n.type === 'FRAME').map(n => n.id));
const exp = await fetch(
`https://api.figma.com/v1/images/${FILE}?ids=${frameIds.join(',')}&format=png&scale=2`,
{ headers: { 'X-Figma-Token': TOKEN } }
);
const { images } = await exp.json(); // { id: url }
```
### Token export → Style Dictionary
```typescript
// figma-token-bridge plugin output
const tokens = figma.variables.getLocalVariables().map(v => ({
name: v.name.replace(/\//g, '.'),
value: v.valuesByMode[defaultMode],
type: v.resolvedType,
}));
figma.ui.postMessage({ type: 'export', tokens });
// Then transform to Style Dictionary JSON → CSS / iOS / Android.
```
### Auto-layout (component definition)
```typescript
const frame = figma.createFrame();
frame.layoutMode = 'HORIZONTAL';
frame.primaryAxisAlignItems = 'CENTER';
frame.counterAxisAlignItems = 'CENTER';
frame.itemSpacing = 8;
frame.paddingLeft = frame.paddingRight = 16;
frame.paddingTop = frame.paddingBottom = 12;
frame.cornerRadius = 8;
```
### Webhook: sync to repo
```typescript
// Figma webhook → CI → token regenerate → PR
app.post('/figma-webhook', async (req, res) => {
if (req.body.event_type === 'FILE_UPDATE') {
await exec('npm run tokens:pull && npm run tokens:build');
await octokit.pulls.create({ /* ... */ });
}
res.sendStatus(200);
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 디자인 시스템 신규 구축 | Variables + Component + auto-layout |
| 디자인-코드 sync | Webhook + Style Dictionary pipeline |
| Vector illustration | Figma 또는 매 Illustrator (Figma 충분 in 2026) |
| 3D/motion | Figma X — Spline / After Effects |
| Real-time whiteboard | FigJam |
**기본값**: Component + auto-layout + variable. Style 은 매 deprecated.
## 🔗 Graph
- 변형: [[FigJam]]
- 응용: [[Design System]] · [[Dev Mode]]
- Adjacent: [[Style Dictionary Pipelines|Style Dictionary]] · [[Storybook]] · [[Tokens Studio]]
## 🤖 LLM 활용
**언제**: Design system architecture, plugin authoring, design-code pipeline.
**언제 X**: Vector math 자체 — SVG/Skia primitive 학습 우선.
## ❌ 안티패턴
- **Detached instance 남발**: 매 component 의 의미 사라짐.
- **Style + Variable 혼용**: 매 variable 로 통일.
- **No naming convention**: `Frame 1234` 가 매 디자인 시스템 죽임.
- **Manual handoff (JPG export)**: Dev Mode 또는 매 token pipeline 사용.
- **Unversioned**: Branching feature (Org plan) 사용.
## 🧪 검증 / 중복
- Verified (Figma docs, Plugin API ref, Dev Mode 2024 release notes).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Figma primitives + plugin/REST/token patterns |
@@ -0,0 +1,175 @@
---
id: wiki-2026-0508-flame-graphs
title: Flame Graphs
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Flamegraph, Stack Trace Visualization, Brendan Gregg Flame Graph]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [profiling, performance, observability, perf, ebpf]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: rust
framework: perf-pyspy-pprof
---
# Flame Graphs
## 매 한 줄
> **"매 stack trace 의 SVG-ified hierarchy"**. Brendan Gregg (2011) 가 만든 매 visualization — 매 x축은 alphabetical (NOT time), 매 y축은 stack depth, 매 width 는 sample count. 매 hot path 가 매 wide flat plateau 로 즉시 보임. 매 2026 현재 perf, eBPF, py-spy, async-profiler, pprof, Pyroscope 등 매 모든 profiler 가 native output.
## 매 핵심
### 매 읽는 법
- **Width = time spent** (sample count proportional). 매 wide = hot.
- **Y = stack depth**. 매 bottom = entry, top = leaf.
- **Color = arbitrary** (typically random hue per function — visual separation only).
- **Plateau at top** = leaf function 의 CPU bound.
- **Tower** = deep call chain (recursion 또는 framework overhead).
### 매 variant
- **CPU flame graph**: 매 on-CPU sample 만 — classic.
- **Off-CPU flame graph**: 매 blocked time (I/O, lock wait) — 매 latency 분석.
- **Differential flame graph**: 매 두 profile 의 diff — red = slower, blue = faster.
- **Icicle (inverted)**: top-down — 매 entry-point 분석에 좋음.
- **Continuous profiling**: 매 Pyroscope / Grafana Phlare 가 매 production 에 항상 켜짐.
### 매 도구 매핑
1. **Linux native**: `perf record -F 99 -g` + Brendan Gregg's FlameGraph perl script.
2. **eBPF**: `bcc/profile`, `parca-agent` — kernel + user 통합.
3. **Python**: `py-spy record -o flame.svg --pid $PID`.
4. **JVM**: `async-profiler -e cpu -d 30 -f flame.html $PID`.
5. **Go**: `go tool pprof -http=:8080 cpu.prof` (built-in flame graph).
6. **Node.js**: `0x` or `clinic flame`.
## 💻 패턴
### Linux perf → flame graph
```bash
# 1. Sample 99 Hz for 30s, capture stacks
sudo perf record -F 99 -a -g -- sleep 30
# 2. Convert to folded format
sudo perf script | \
~/FlameGraph/stackcollapse-perf.pl > out.folded
# 3. Render SVG
~/FlameGraph/flamegraph.pl out.folded > flame.svg
# Open in browser → click to zoom, search regex highlights
```
### Differential flame graph (before/after)
```bash
~/FlameGraph/stackcollapse-perf.pl < before.perf > before.folded
~/FlameGraph/stackcollapse-perf.pl < after.perf > after.folded
~/FlameGraph/difffolded.pl before.folded after.folded | \
~/FlameGraph/flamegraph.pl --negate > diff.svg
```
### Continuous profiling with Pyroscope (Go)
```go
import "github.com/grafana/pyroscope-go"
func main() {
pyroscope.Start(pyroscope.Config{
ApplicationName: "checkout-service",
ServerAddress: "http://pyroscope:4040",
Logger: pyroscope.StandardLogger,
Tags: map[string]string{"region": "us-west-2"},
ProfileTypes: []pyroscope.ProfileType{
pyroscope.ProfileCPU,
pyroscope.ProfileAllocObjects,
pyroscope.ProfileInuseObjects,
},
})
runServer()
}
```
### py-spy on running Python service
```bash
# 30s sample, draw flame graph
py-spy record -o flame.svg --pid 12345 --duration 30 --rate 100
# Native + Python frames combined
py-spy record -o flame.svg --pid 12345 --native
# Top-like live view
py-spy top --pid 12345
```
### async-profiler for JVM
```bash
# CPU profile (30s) → flamegraph HTML
./profiler.sh -e cpu -d 30 -f flame.html $(jps | grep MyApp | awk '{print $1}')
# Allocation profile
./profiler.sh -e alloc -d 60 -f alloc.html $PID
# Wall-clock (off-CPU + on-CPU)
./profiler.sh -e wall -t -d 30 -f wall.html $PID
```
### Off-CPU flame graph (eBPF / bcc)
```bash
# Capture off-CPU stacks (blocked time) for 30s
sudo /usr/share/bcc/tools/offcputime -df -p $PID 30 > offcpu.folded
~/FlameGraph/flamegraph.pl --color=io --title="Off-CPU" \
offcpu.folded > offcpu.svg
```
### pprof flame graph (Go built-in)
```go
import _ "net/http/pprof"
go func() { http.ListenAndServe("localhost:6060", nil) }()
// Then on dev machine:
// go tool pprof -http=:8080 http://service:6060/debug/pprof/profile?seconds=30
// → opens browser, click "View" → "Flame Graph"
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Production continuous | Pyroscope / Grafana Phlare / Polar Signals |
| Linux ad-hoc | perf + FlameGraph |
| Python | py-spy (zero-instrumentation) |
| JVM | async-profiler (allocation + CPU + wall) |
| Go | built-in pprof + go tool pprof |
| Node | 0x or clinic flame |
| Latency / blocked | Off-CPU flame graph (eBPF) |
**기본값**: 매 production 에 Pyroscope + 매 dev 에 native profiler.
## 🔗 Graph
- 부모: [[Profiling]]
- 응용: [[SRE]]
- Adjacent: [[eBPF]]
## 🤖 LLM 활용
**언제**: 매 flame graph 의 hot frame 식별 + optimization 제안, folded text → 자연어 summary, differential interpretation.
**언제 X**: 매 visual exact pixel reading — 매 SVG 자체 사용.
## ❌ 안티패턴
- **Sampling rate too low**: 매 19 Hz — 매 short hot function miss. 매 99 Hz 표준.
- **Without -g (no callgraphs)**: 매 perf record -g 누락 — 매 frames frame 만 보임.
- **No frame pointers (Go ≤1.20, glibc)**: 매 stack unwind 실패 — `-fno-omit-frame-pointer` 또는 DWARF.
- **Reading width as time order**: 매 x축은 time 의 X — alphabetical sort.
- **Production profiling once a year**: 매 continuous 의 가치를 놓침.
## 🧪 검증 / 중복
- Verified (Brendan Gregg 2011, Pyroscope/Grafana Labs 2026).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — flame graph reading guide + perf/py-spy/pprof recipes |
@@ -0,0 +1,194 @@
---
id: wiki-2026-0508-formal-verification-of-software
title: Formal Verification of Software
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Formal Methods, Program Verification]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [formal-methods, verification, correctness]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Coq/Lean/TLA+
framework: Dafny/F*
---
# Formal Verification of Software
## 매 한 줄
> **"매 prove correctness, 매 test correctness 의 X"**. Formal verification 의 mathematical proof 의 program 의 specification 에 대한 conformance — 매 testing 의 fundamental superset. 2026 의 industrial use 의 expanding (AWS s2n-tls, sel4, CompCert, Cardano, Dafny in MS, Lean 4 의 mathlib).
## 매 핵심
### 매 Spectrum of rigor
1. **Type systems**: lightweight, daily (TypeScript, Rust borrow checker).
2. **Property-based testing**: empirical, partial (QuickCheck).
3. **Model checking**: finite-state exhaustive (TLA+, SPIN).
4. **Deductive verification**: machine-checked proofs (Coq, Lean, Dafny, F*).
5. **Refinement**: high-level spec → low-level impl preserves properties (Event-B).
### 매 Tools (2026 leaders)
- **TLA+**: distributed system specs (used by AWS, Azure for protocols).
- **Coq / Lean 4**: dependent types, proof assistant.
- **Dafny**: verification-aware imperative language (MS).
- **F***: ML-style with refinement types (HACL* crypto, EverParse).
- **Kani / Creusot**: Rust verification.
- **CBMC**: bounded model checker for C.
### 매 What gets verified
- Algorithmic correctness (sorting, hashing).
- Protocol safety (no deadlock, agreement).
- Memory safety (no UAF, overflow).
- Cryptographic implementations (HACL* used in Linux, Firefox).
- Compiler correctness (CompCert).
- OS kernel (seL4 — full functional correctness).
### 매 응용
1. Safety-critical (avionics DO-178C Level A, automotive ISO 26262).
2. Crypto libraries (HACL*, Project Everest).
3. Distributed protocols (Paxos, Raft TLA+).
4. Smart contracts (Cardano Plutus, MoveProver).
5. Compilers / kernels (CompCert, seL4).
## 💻 패턴
### TLA+ — distributed mutex spec
```tla
---- MODULE Mutex ----
EXTENDS Naturals
VARIABLES queue, holder
Init == queue = <<>> /\ holder = NULL
Request(p) == queue' = Append(queue, p) /\ UNCHANGED holder
Acquire == /\ queue # <<>>
/\ holder = NULL
/\ holder' = Head(queue)
/\ queue' = Tail(queue)
MutualExclusion == \A p, q \in Procs : holder = p /\ holder = q => p = q
THEOREM Spec => []MutualExclusion
====
```
### Dafny — verified binary search
```dafny
method BinarySearch(a: array<int>, key: int) returns (idx: int)
requires forall i, j :: 0 <= i < j < a.Length ==> a[i] <= a[j]
ensures 0 <= idx ==> idx < a.Length && a[idx] == key
ensures idx < 0 ==> forall i :: 0 <= i < a.Length ==> a[i] != key
{
var lo, hi := 0, a.Length;
while lo < hi
invariant 0 <= lo <= hi <= a.Length
invariant forall i :: 0 <= i < lo ==> a[i] < key
invariant forall i :: hi <= i < a.Length ==> a[i] > key
{
var mid := (lo + hi) / 2;
if a[mid] < key { lo := mid + 1; }
else if a[mid] > key { hi := mid; }
else { return mid; }
}
return -1;
}
```
### Lean 4 — proof of a simple lemma
```lean
theorem add_zero (n : Nat) : n + 0 = n := by
induction n with
| zero => rfl
| succ k ih => simp [Nat.succ_add, ih]
```
### F* refinement types
```fsharp
val divide : x:int -> y:int{y <> 0} -> int
let divide x y = x / y
// Compiler proves y <> 0 at every call site — divide-by-zero impossible
```
### Kani — Rust harness
```rust
#[kani::proof]
fn check_sum_no_overflow() {
let a: u32 = kani::any();
let b: u32 = kani::any();
kani::assume(a < 1000 && b < 1000);
let sum = a + b;
assert!(sum == a + b); // proven for ALL inputs in range
}
```
### CBMC — bounded check on C
```c
#include <assert.h>
int main() {
int x = nondet_int();
__CPROVER_assume(x >= 0 && x < 100);
int y = x * x;
assert(y >= 0);
return 0;
}
// cbmc file.c → reports counterexample if assertion fails
```
### Property + spec hybrid (Hypothesis)
```python
from hypothesis import given, strategies as st
@given(st.lists(st.integers()))
def test_sort_preserves_length(xs):
assert len(sorted(xs)) == len(xs)
@given(st.lists(st.integers()))
def test_sort_is_ordered(xs):
s = sorted(xs)
assert all(s[i] <= s[i+1] for i in range(len(s)-1))
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Web app daily | Strong types + property tests |
| Distributed protocol | TLA+ model |
| Crypto primitive | F* / HACL* |
| Smart contract | MoveProver / Plutus |
| OS / hypervisor | Coq / seL4-style |
| Rust kernel code | Kani / Creusot |
**기본값**: types everywhere + property-based for parsers + TLA+ for distributed designs + reach for proof assistants only when life/billions on the line.
## 🔗 Graph
- 부모: [[Computer_Science_and_Theory]]
- 변형: [[Type-safe Error Handling Exhaustiveness Checking]] · [[TypeScript 타입 시스템 (TypeScript Type System)|Type Systems]]
- 응용: [[Practical-Cryptography]] · [[SAST]]
- Adjacent: [[Quality-Control]] · [[Test_Automation]]
## 🤖 LLM 활용
**언제**: draft TLA+ specs from prose descriptions, suggest invariants, explain failing proofs.
**언제 X**: never trust LLM-generated proof without checker (Lean/Coq) verifying.
## ❌ 안티패턴
- **Spec ≠ implementation**: verify spec, ship different code.
- **Unverified assumptions**: proofs depend on `axiom` blocks that hide bugs.
- **Verify everything**: cost > benefit for typical CRUD.
- **No model**: claim "formally verified" with handwaved diagram.
## 🧪 검증 / 중복
- Verified (Lamport TLA+ book, Pierce SF, AWS Builders Library 2024 formal methods).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — spectrum + tool examples |
@@ -0,0 +1,198 @@
---
id: wiki-2026-0508-frustum-culling
title: Frustum Culling
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [View Frustum Culling, VFC, Camera Culling]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [graphics, rendering, culling, optimization, gpu]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: cpp
framework: opengl-vulkan-unity
---
# Frustum Culling
## 매 한 줄
> **"매 carmera 의 view volume (frustum) 밖 object 의 매 draw skip"**. 매 가장 기본적이고 가장 효과적인 매 visibility culling — 매 30-90% draw call 감소가 일반적. 매 modern engine (Unreal 5 Nanite, Unity HDRP, bevy) 은 매 GPU-driven culling 으로 매 millions of objects 를 매 compute shader 안에서 매 frame 마다 cull.
## 매 핵심
### 매 frustum 표현
- **6 planes**: near, far, left, right, top, bottom.
- 매 plane equation: `ax + by + cz + d = 0` with `(a,b,c)` = inward normal.
- 매 view-projection matrix 의 매 row combo 로 6 planes extract (Gribb-Hartmann).
### 매 bounding volume choice
- **AABB (axis-aligned)**: 매 cheapest, 매 conservative — 매 large rotated objects 매 over-conservative.
- **OBB (oriented)**: 매 tighter, 매 더 expensive.
- **Sphere**: 매 cheapest test (single dot product), 매 loosest.
- **Plane mask (frustum culling with masks)**: 매 children inherit parent 의 "fully inside" plane.
### 매 알고리즘 흐름
1. View-projection matrix → 6 frustum planes.
2. 매 object 의 BV 와 매 6 planes test.
3. **Outside** any plane → cull.
4. **Inside** all → render.
5. **Intersect** → render (or recurse children if hierarchy).
### 매 modern (GPU-driven)
- **Compute shader** 가 매 draw arguments buffer 를 build (`DrawIndirect`).
- 매 millions of objects 도 매 sub-millisecond.
- 매 hierarchical Z-buffer occlusion + frustum 결합 (Nanite).
## 💻 패턴
### Extract frustum planes from VP matrix (Gribb-Hartmann)
```cpp
struct Plane { glm::vec3 n; float d; };
void extractPlanes(const glm::mat4& vp, Plane out[6]) {
auto m = glm::transpose(vp); // row-major helper
out[0] = { glm::vec3(m[3]+m[0]), m[3].w + m[0].w }; // left
out[1] = { glm::vec3(m[3]-m[0]), m[3].w - m[0].w }; // right
out[2] = { glm::vec3(m[3]+m[1]), m[3].w + m[1].w }; // bottom
out[3] = { glm::vec3(m[3]-m[1]), m[3].w - m[1].w }; // top
out[4] = { glm::vec3(m[3]+m[2]), m[3].w + m[2].w }; // near
out[5] = { glm::vec3(m[3]-m[2]), m[3].w - m[2].w }; // far
for (int i = 0; i < 6; i++) {
float len = glm::length(out[i].n);
out[i].n /= len; out[i].d /= len;
}
}
```
### Sphere vs frustum (cheapest)
```cpp
bool sphereInFrustum(const Plane planes[6], const glm::vec3& c, float r) {
for (int i = 0; i < 6; i++)
if (glm::dot(planes[i].n, c) + planes[i].d < -r) return false;
return true;
}
```
### AABB vs frustum (positive vertex / p-vertex test)
```cpp
bool aabbInFrustum(const Plane planes[6], const glm::vec3& mn, const glm::vec3& mx) {
for (int i = 0; i < 6; i++) {
glm::vec3 p = {
planes[i].n.x >= 0 ? mx.x : mn.x,
planes[i].n.y >= 0 ? mx.y : mn.y,
planes[i].n.z >= 0 ? mx.z : mn.z
};
if (glm::dot(planes[i].n, p) + planes[i].d < 0) return false;
}
return true;
}
```
### BVH-based hierarchical culling
```cpp
void cullBVH(const BVHNode& node, const Plane planes[6], std::vector<int>& visible) {
auto r = aabbVsFrustumIntersect(planes, node.aabb);
if (r == OUTSIDE) return;
if (r == INSIDE) { addAll(node, visible); return; }
if (node.isLeaf) {
for (int idx : node.objects)
if (aabbInFrustum(planes, objs[idx].mn, objs[idx].mx))
visible.push_back(idx);
return;
}
cullBVH(*node.left, planes, visible);
cullBVH(*node.right, planes, visible);
}
```
### GPU compute culling (HLSL)
```hlsl
// CullCS.hlsl
StructuredBuffer<ObjectData> objects : register(t0);
ConstantBuffer<FrustumCB> frustum : register(b0);
RWStructuredBuffer<DrawArgs> drawArgs : register(u0);
RWByteAddressBuffer counter : register(u1);
[numthreads(64, 1, 1)]
void main(uint3 id : SV_DispatchThreadID) {
if (id.x >= objects.Length) return;
ObjectData o = objects[id.x];
bool visible = true;
[unroll] for (int i = 0; i < 6; i++) {
float4 p = frustum.planes[i];
if (dot(p.xyz, o.center) + p.w < -o.radius) { visible = false; break; }
}
if (visible) {
uint slot;
counter.InterlockedAdd(0, 1, slot);
drawArgs[slot].vertexCount = o.indexCount;
drawArgs[slot].instanceCount = 1;
drawArgs[slot].firstIndex = o.firstIndex;
drawArgs[slot].baseInstance = id.x;
}
}
```
### Unity (Burst) culling job
```csharp
[BurstCompile]
struct FrustumCullJob : IJobParallelFor {
[ReadOnly] public NativeArray<float4> planes; // 6 planes
[ReadOnly] public NativeArray<float4> bounds; // xyz=center, w=radius
[WriteOnly] public NativeArray<bool> visible;
public void Execute(int i) {
float4 b = bounds[i];
for (int p = 0; p < 6; p++) {
float4 pl = planes[p];
if (math.dot(pl.xyz, b.xyz) + pl.w < -b.w) {
visible[i] = false;
return;
}
}
visible[i] = true;
}
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| <1k objects, CPU | per-object sphere/AABB test |
| 1k-100k, hierarchical | BVH / Octree + frustum |
| 100k+ static, GPU | compute shader + DrawIndirect |
| Massive (Nanite-class) | GPU-driven + HZB occlusion |
| Animated skeletal | use skinned bounds (loose) |
**기본값**: 매 modern engine — GPU compute culling + BVH for spatial queries.
## 🔗 Graph
- 부모: [[Real-Time Rendering]]
- 응용: [[GPU-Driven Rendering]] · [[Nanite]]
- Adjacent: [[BVH]] · [[Octree]]
## 🤖 LLM 활용
**언제**: plane extraction code 검토, false-cull bug 디버깅 (e.g., flipped normal), GPU shader skeleton.
**언제 X**: 매 actual rendering decision 의 runtime correctness — unit test + visual verification.
## ❌ 안티패턴
- **No bounding volume cache**: 매 frame 마다 매 mesh 의 bound 재계산 — pre-compute.
- **Sphere only for everything**: 매 long thin object 매 over-conservative.
- **Plane normalization 누락**: 매 distance comparison 부정확.
- **Cull camera == render camera 가정**: 매 shadow camera, planar reflection 시 매 잘못.
- **Animated bound 무시**: 매 skinned mesh 의 bound 가 매 outdated → pop in/out.
## 🧪 검증 / 중복
- Verified (Real-Time Rendering 4th ed, Gribb-Hartmann 2001, Unreal Nanite docs 2026).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — frustum extraction + BV tests + GPU-driven |
@@ -0,0 +1,150 @@
---
id: wiki-2026-0508-geometry-merging
title: Geometry Merging
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Mesh Merging, Static Batching, Geometry Batching]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [graphics, optimization, rendering, gpu]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C++/HLSL
framework: Unity/Unreal/Three.js
---
# Geometry Merging
## 매 한 줄
> **"매 여러 mesh 를 매 단일 vertex/index buffer 로 합쳐 매 draw call 수를 매 줄이는 기법"**. CPU-GPU command overhead 의 매 frame budget 의 매 dominant share 였던 시대의 매 staple optimization. 매 modern era — GPU instancing, indirect draw, mesh shader 가 매 알 수 있게 대체했지만 매 static scene, mobile, low-end 에서 매 still relevant.
## 매 핵심
### 매 종류
- **Static batching**: build-time 에 같은 material 의 static mesh 합침.
- **Dynamic batching**: runtime 에 small mesh 를 transform & merge (CPU cost ↑).
- **GPU instancing**: 같은 mesh 여러 transform — merging 의 modern 대체.
- **Mesh atlas (texture array)**: material 통합으로 merge 가능 범위 확장.
### 매 trade-off
- ↑ Throughput (fewer draw call).
- ↓ Culling 정확도 (merged AABB 가 매 커짐).
- ↑ Memory (per-vertex data 의 매 duplication).
- ↓ Animation flexibility (static 한정).
### 매 응용
1. Mobile 게임 — draw call 의 매 hard limit (~100-200).
2. Architectural visualization — 매 thousands of small props.
3. Tile-based world streaming.
4. UI batching (text glyph atlas).
## 💻 패턴
### Manual merge (Three.js)
```javascript
import { mergeGeometries } from 'three/examples/jsm/utils/BufferGeometryUtils.js';
const geos = props.map(p => p.geometry.clone().applyMatrix4(p.matrixWorld));
const merged = mergeGeometries(geos, false);
const mesh = new THREE.Mesh(merged, sharedMaterial);
scene.add(mesh);
// 1000 draw calls → 1
```
### Unity static batching
```csharp
// Mark objects as static in Inspector → Unity merges at build time.
// Or runtime:
StaticBatchingUtility.Combine(rootGameObject);
// Caveat: combined mesh 64k vertex 한도 (16-bit index).
```
### GPU instancing (preferred over merge)
```glsl
// vertex shader (Unity URP)
struct Attributes {
float3 positionOS : POSITION;
UNITY_VERTEX_INPUT_INSTANCE_ID
};
UNITY_INSTANCING_BUFFER_START(Props)
UNITY_DEFINE_INSTANCED_PROP(float4, _Color)
UNITY_INSTANCING_BUFFER_END(Props)
Varyings vert(Attributes IN) {
UNITY_SETUP_INSTANCE_ID(IN);
// ...
}
```
### Texture atlas (enable merging across materials)
```python
# Bake separate textures into one atlas → assign UV remap.
import numpy as np
atlas = np.zeros((2048, 2048, 4), np.uint8)
uv_remap = {}
for i, tex in enumerate(textures):
x, y = (i % 8) * 256, (i // 8) * 256
atlas[y:y+256, x:x+256] = tex
uv_remap[i] = (x/2048, y/2048, 256/2048, 256/2048)
# Then rewrite mesh UVs per material id.
```
### Multi-draw indirect (modern alt)
```cpp
// Instead of merging, keep mesh separate but submit via single indirect call.
struct DrawCmd { uint32_t indexCount, instanceCount, firstIndex, vertexOffset, firstInstance; };
std::vector<DrawCmd> cmds; // one per visible mesh
glMultiDrawElementsIndirect(GL_TRIANGLES, GL_UNSIGNED_INT, cmds.data(), cmds.size(), 0);
```
### Hierarchical merge (octree)
```python
def merge_octree(node):
if node.is_leaf and len(node.meshes) > 1:
node.merged = merge(node.meshes)
else:
for c in node.children: merge_octree(c)
# Coarse cull on octree node, fine draw merged buffer.
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 同 mesh 다수 | GPU instancing (best) |
| Static, 多 unique mesh | Static merging + atlas |
| Modern API (Vk/D3D12) | Indirect draw + bindless |
| Mobile / WebGL legacy | Static batching + atlas |
| Animated / dynamic transform | Per-object draw + culling |
**기본값**: Modern HW → instancing/indirect. Legacy → static merge + atlas.
## 🔗 Graph
- 부모: [[Rendering Optimization]] · [[Draw Call]]
- 변형: [[GPU Instancing]] · [[Indirect Draw]]
- 응용: [[Texture Atlas]] · [[Octree]] · [[BVH]]
- Adjacent: [[Frustum Culling]] · [[LOD]]
## 🤖 LLM 활용
**언제**: Mobile / web renderer 최적화, asset pipeline 설계.
**언제 X**: Highly dynamic scenes (animation/destruction).
## ❌ 안티패턴
- **Merge everything**: 매 culling 효과 무력화.
- **Material 다른 mesh merge**: shader switch 강제 → benefit 없음.
- **Skinned mesh static merge**: 매 animation broken.
- **64k vertex 한계 모름**: 16-bit index 의 매 silent overflow.
- **Modern API 에서 merge 만 사용**: indirect/instancing 무시.
## 🧪 검증 / 중복
- Verified (Unity docs, Three.js BufferGeometryUtils, GPU Pro series).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — merging vs instancing/indirect 의 trade-off |
@@ -0,0 +1,187 @@
---
id: wiki-2026-0508-global-network-positioning-gnp
title: Global Network Positioning (GNP)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [GNP, Network Coordinates, Network Positioning, Vivaldi]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [networking, latency-prediction, distributed-systems, p2p, coordinates]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: go
framework: vivaldi-coords
---
# Global Network Positioning (GNP)
## 매 한 줄
> **"매 host 를 매 low-D Euclidean space 의 point 로 embed — 매 distance 가 매 network latency 의 predictor"**. Ng & Zhang (SIGCOMM 2002) 의 GNP — 매 landmark 기반 절대 좌표 — 가 매 idea 의 시초. 매 후속작 Vivaldi (Dabek 2004) 가 매 decentralized 형태로 매 P2P / overlay network 에 광범위하게 사용. 매 2026 의 application 은 매 CDN edge selection, DHT routing, server placement.
## 매 핵심
### 매 GNP (centralized) 의 idea
- **Landmark hosts** (예: 15-20개) 가 매 Internet 곳곳에 배치.
- 매 RTT 측정 후 landmark 들의 매 좌표를 매 fixed point 로 fitting (multidim scaling).
- 매 new host 는 매 landmark 들에 ping → 매 자기 좌표 solve.
- 매 두 host 간 RTT ≈ Euclidean distance.
### 매 Vivaldi (decentralized) 의 차이
- Landmark X — 매 모든 peer 가 random subset 와 매 RTT 교환.
- 매 spring relaxation: 매 over/under-estimated 매 vector 만큼 push/pull.
- 매 height augmentation (extra non-Euclidean dim) 으로 매 access link 의 last-mile 표현.
- 매 dynamic — peer churn 에 자동 적응.
### 매 application
1. **CDN routing**: 매 client 좌표 → 매 nearest edge.
2. **DHT optimization**: 매 finger table 을 매 latency-aware 로 선택.
3. **Server selection**: 매 mirror / replica 중 가장 가까운 매 fetch.
4. **Network tomography**: 매 latency map 시각화.
5. **P2P overlays**: BitTorrent, Skype 가 매 사용 (legacy).
## 💻 패턴
### GNP-style landmark fitting (NumPy)
```python
import numpy as np
from scipy.optimize import minimize
def fit_landmarks(rtt_matrix, dim=4):
"""rtt_matrix[i][j] = measured RTT between landmark i,j (ms)."""
n = rtt_matrix.shape[0]
x0 = np.random.rand(n * dim) * 50
def stress(x):
coords = x.reshape(n, dim)
err = 0.0
for i in range(n):
for j in range(i + 1, n):
d = np.linalg.norm(coords[i] - coords[j])
err += ((d - rtt_matrix[i, j]) / rtt_matrix[i, j]) ** 2
return err
res = minimize(stress, x0, method='L-BFGS-B')
return res.x.reshape(n, dim)
def position_new_host(rtts_to_landmarks, landmark_coords, dim=4):
def stress(x):
return sum(
((np.linalg.norm(x - landmark_coords[i]) - rtts_to_landmarks[i])
/ rtts_to_landmarks[i]) ** 2
for i in range(len(rtts_to_landmarks))
)
res = minimize(stress, np.zeros(dim), method='L-BFGS-B')
return res.x
```
### Vivaldi spring relaxation step (Go)
```go
type Coord struct {
Vec []float64 // Euclidean dims
Height float64 // last-mile
Err float64 // local error estimate
}
const (
Ce = 0.25 // error sensitivity
Cc = 0.25 // coord change sensitivity
)
// Update local coord after measuring rtt to peer with peerCoord
func (c *Coord) Update(rtt float64, peerCoord Coord) {
w := c.Err / (c.Err + peerCoord.Err)
predicted := dist(c.Vec, peerCoord.Vec) + c.Height + peerCoord.Height
es := math.Abs(predicted-rtt) / rtt
c.Err = es*Ce*w + c.Err*(1-Ce*w)
delta := Cc * w
direction := unit(sub(c.Vec, peerCoord.Vec))
force := (rtt - predicted) * delta
for i := range c.Vec {
c.Vec[i] += direction[i] * force
}
c.Height = math.Max(0, c.Height+(rtt-predicted)*delta*0.5)
}
```
### Edge selection from coordinates
```go
func selectEdge(client Coord, edges []EdgeNode) *EdgeNode {
var best *EdgeNode
bestRTT := math.Inf(1)
for i, e := range edges {
rtt := dist(client.Vec, e.Coord.Vec) + client.Height + e.Coord.Height
if rtt < bestRTT {
bestRTT = rtt
best = &edges[i]
}
}
return best
}
```
### CDN-style anycast hybrid (BGP + GNP fallback)
```python
def route(client_ip):
# Try anycast result first (BGP picks PoP)
pop = anycast_lookup(client_ip)
if pop and recent_health(pop):
return pop
# Fallback: use GNP coords from RIPE Atlas / Cedexis
coord = lookup_client_coord(client_ip)
return min(EDGES, key=lambda e: euclid(coord, e.coord) + e.height + coord.height)
```
### Stress test (predicted vs actual)
```python
def evaluate(coords, ground_truth_rtt):
rel_err = []
for (i, j), actual in ground_truth_rtt.items():
pred = np.linalg.norm(coords[i] - coords[j])
rel_err.append(abs(pred - actual) / actual)
return {
'median_rel_err': np.median(rel_err),
'p90_rel_err': np.percentile(rel_err, 90),
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Centralized infra, fixed landmarks | GNP |
| P2P / dynamic peer set | Vivaldi |
| <100 nodes | Direct measurement (skip embedding) |
| Global CDN | Anycast + GNP fallback |
| Triangle inequality violations frequent | Add height (Vivaldi) or non-Euclidean |
**기본값**: 매 modern usage — Vivaldi w/ height (4D + height).
## 🔗 Graph
- 부모: [[Distributed Systems]]
- 변형: [[Vivaldi]]
- 응용: [[CDN]]
## 🤖 LLM 활용
**언제**: 매 algorithm 설명, 매 stress function tuning 제안, embedding dimension 선택 기준.
**언제 X**: 매 real-time coord update — 매 measured RTT 만이 truth.
## ❌ 안티패턴
- **2D 만 사용**: 매 triangle inequality 자주 violated — 매 4D + height.
- **No error tracking**: 매 Vivaldi 의 local error term 빠짐 → unstable.
- **Static landmarks 의 churn 무시**: 매 landmark 매 fail 시 — health check 필수.
- **Use embedding distance for security**: 매 거리는 매 latency proxy 일 뿐 — 매 trust 의 X.
## 🧪 검증 / 중복
- Verified (Ng & Zhang SIGCOMM 2002, Dabek SIGCOMM 2004).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — GNP/Vivaldi math + edge selection patterns |
@@ -0,0 +1,166 @@
---
id: wiki-2026-0508-google-code-jam-dataset
title: Google Code Jam Dataset
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [GCJ Dataset, Code Jam Solutions Corpus, GCJ-297]
duplicate_of: none
source_trust_level: B
confidence_score: 0.85
verification_status: applied
tags: [dataset, code-llm, benchmark, programming-competition, deduplication]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: huggingface-datasets
---
# Google Code Jam Dataset
## 매 한 줄
> **"매 Google Code Jam 의 매 historical archive — 매 code clone detection / code LLM evaluation 의 standard corpus"**. Google 의 매 annual programming competition (2003-2023) 이 매 retire 되었지만 매 solution corpus 는 매 academic 으로 풍부 — 매 multiple solutions per problem, 매 다양한 언어 — 매 code clone, code translation, code-LM benchmark 의 raw material. 매 가장 많이 인용되는 매 GCJ-297 (Bui et al.) 로 매 297 problem × multiple langs.
## 매 핵심
### 매 dataset 의 특이성
- **Same-intent, varied implementations**: 매 단일 problem 에 매 thousands of correct solutions — 매 semantic equivalence 가 ground truth.
- **Multi-language**: C++, Java, Python, Go, Kotlin, …
- **Difficulty stratification**: Qualification → Round 1/2/3 → World Finals.
- **Test cases**: official input/output 이 partial 공개 (sample only) — full hidden.
### 매 main variants
1. **GCJ-297** (Bui et al. 2017): 297 problems, ~120k solutions, code clone benchmark.
2. **CodeNet** (IBM 2021): 매 GCJ + AIZU — 14M solutions, 4053 problems, 55 langs (superset).
3. **MBXP / HumanEval-X**: 매 not GCJ-derived 지만 매 같은 비교 대상 benchmark.
4. **APPS**: Codeforces + AtCoder + Code Jam mix — 매 LLM coding benchmark.
### 매 use cases
- **Code clone detection**: 매 Type-1/2/3/4 clone 의 ground truth.
- **Code LLM eval**: 매 contamination 위험 매 큼 — 매 Code Jam 매 GitHub 에 publicly indexed.
- **Translation**: 매 Java solution → 매 Python solution.
- **Style transfer**: 매 verbose vs 매 idiomatic.
## 💻 패턴
### Loading via Hugging Face
```python
from datasets import load_dataset
# CodeNet (largest superset including GCJ)
ds = load_dataset("Project-CodeNet/codenet", split="train", streaming=True)
for ex in ds.take(3):
print(ex["problem_id"], ex["language"], ex["status"], len(ex["code"]))
```
### Filter for GCJ subset only
```python
gcj = ds.filter(lambda x: x["dataset_origin"] == "google_code_jam")
print(gcj.info.splits)
```
### Group solutions by problem_id (clone-detection setup)
```python
from collections import defaultdict
buckets = defaultdict(list)
for ex in gcj:
if ex["status"] == "Accepted":
buckets[ex["problem_id"]].append(ex)
# Pair within bucket = positive (clone), across bucket = negative
positive_pairs = [(a, b) for sols in buckets.values()
for a, b in itertools.combinations(sols, 2)]
```
### Decontamination check (LLM training data)
```python
import hashlib
def near_dup_hash(code: str, k=5) -> set[int]:
tokens = code.split()
return {hash(' '.join(tokens[i:i+k])) for i in range(len(tokens) - k)}
train_hashes = set()
for ex in train_corpus:
train_hashes |= near_dup_hash(ex["code"])
contaminated = [
ex for ex in gcj_eval
if len(near_dup_hash(ex["code"]) & train_hashes) / max(1, len(near_dup_hash(ex["code"]))) > 0.5
]
print(f"contamination ratio: {len(contaminated) / len(gcj_eval):.2%}")
```
### Compile + run sandbox (judging on test cases)
```python
import subprocess, tempfile, pathlib
def judge(code: str, lang: str, stdin: str, expected: str, timeout=5):
with tempfile.TemporaryDirectory() as d:
p = pathlib.Path(d) / ("sol." + {"python": "py", "cpp": "cpp"}[lang])
p.write_text(code)
if lang == "cpp":
subprocess.run(["g++", "-O2", "-std=c++20", str(p), "-o", f"{d}/a"], check=True)
cmd = [f"{d}/a"]
else:
cmd = ["python3", str(p)]
try:
r = subprocess.run(cmd, input=stdin, capture_output=True, text=True, timeout=timeout)
return r.stdout.strip() == expected.strip()
except subprocess.TimeoutExpired:
return False
```
### Train/eval split for code translation
```python
import random
random.seed(0)
problems = list(buckets.keys())
random.shuffle(problems)
train_pids = set(problems[:int(0.9 * len(problems))])
train, eval = [], []
for pid, sols in buckets.items():
java = [s for s in sols if s["language"] == "java"]
py = [s for s in sols if s["language"] == "python"]
pairs = list(itertools.product(java, py))
(train if pid in train_pids else eval).extend(
{"src": j["code"], "tgt": p["code"]} for j, p in pairs
)
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Code clone benchmark | GCJ-297 (Bui et al.) |
| LLM coding eval | APPS or HumanEval (less contaminated) |
| Code translation | CodeNet pair-wise |
| Style benchmark | GCJ multi-solution per problem |
| Live evaluation | NEVER use GCJ alone (contamination) |
**기본값**: 매 LLM eval — APPS/HumanEval 매 main + GCJ 매 supplementary.
## 🔗 Graph
- 변형: [[HumanEval]]
## 🤖 LLM 활용
**언제**: 매 dataset filter pipeline 작성, contamination 검사 design, problem grouping logic.
**언제 X**: 매 LLM 자체 평가 — 매 GCJ 가 매 training data 에 포함되어 있을 확률 높음 (contamination).
## ❌ 안티패턴
- **GCJ for SOTA LLM eval without dedup**: 매 contamination 으로 매 score inflation.
- **Sample IO 만 사용**: 매 wrong-answer 가 매 test-case 통과 가능.
- **No timeout in judging**: 매 infinite loop 으로 OOM/hang.
- **Mixing accepted + WA**: 매 ground truth 의 정확성 저하.
- **Ignoring problem difficulty**: 매 stratified eval 필수.
## 🧪 검증 / 중복
- Verified (Bui et al. ICSE 2017, IBM Project CodeNet 2021, Hugging Face Hub).
- 신뢰도 B (semi-public, scraped).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — GCJ corpus + CodeNet usage + decontamination |
@@ -0,0 +1,32 @@
---
id: wiki-2026-0508-hmd-head-mounted-display-기반-엑서게임
title: HMD(Head-Mounted Display) 기반 엑서게임 환경
category: 10_Wiki/Topics
status: duplicate
canonical_id: vr-exergame
duplicate_of: "[[VR Exergame]]"
aliases: []
source_trust_level: A
confidence_score: 0.85
verification_status: redirected
tags: [duplicate, vr, exergame, hmd]
last_reinforced: 2026-05-10
github_commit: pending
---
# HMD(Head-Mounted Display) 기반 엑서게임 환경
> **이 문서는 [[VR Exergame]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (specialization aspects)
- HMD 기반 exergame (운동게임) 환경 — 매 VR 헤드셋 (Quest 3, Vision Pro, PSVR2) 의 매 6DoF tracking + room-scale + presence 가 매 traditional Wii/Kinect 대비 매 immersion ↑.
- 매 한국어 medical/rehab 문헌 에서 자주 등장 — 매 신체활동 + 인지자극 결합.
- Canonical 문서가 매 hardware (HMD, controller, treadmill, haptic suit), 매 game design (Beat Saber, Supernatural, FitXR), 매 health outcome 측정을 통합 관리.
## 🔗 Graph
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — canonical 문서로 redirect |
@@ -0,0 +1,156 @@
---
id: wiki-2026-0508-high-resolution-time
title: High Resolution Time
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [performance.now, Monotonic Time, HR Time, Hi-Res Timer]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [web-api, performance, timing, security]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: JavaScript/C
framework: W3C-HRTime/POSIX
---
# High Resolution Time
## 매 한 줄
> **"매 sub-millisecond 정밀도의 매 monotonic clock"**. W3C High Resolution Time spec — `performance.now()` 가 매 `Date.now()` 의 ms 한계 + wall-clock jitter 를 매 해결. 매 Spectre 후 — 모든 brower 가 매 timer 정밀도를 매 100µs ~ 1ms 로 매 reduce + cross-origin isolation 으로 매 5µs 회복.
## 매 핵심
### 매 vs Date.now
- `Date.now()`: wall clock, ms 단위, NTP 으로 점프 가능 (음수 delta!).
- `performance.now()`: monotonic, fractional ms, navigation start 기준.
### 매 timer attack mitigation
- Spectre/Meltdown (2018) → 매 brower 가 timer fuzz/round.
- Default: 100µs ~ 1ms rounding + jitter.
- COOP+COEP (cross-origin isolated) 시 → 5µs 정밀 + `SharedArrayBuffer`.
### 매 응용
1. Animation frame timing (`rAF` callback).
2. Performance profiling (`User Timing API`).
3. WebGL/WebGPU frame budget tracking.
4. Audio scheduling (`AudioContext.currentTime` 동기).
## 💻 패턴
### Basic timing
```javascript
const t0 = performance.now();
heavyWork();
const elapsed = performance.now() - t0;
console.log(`took ${elapsed.toFixed(3)} ms`); // 12.345 ms
```
### User Timing API (DevTools 표시)
```javascript
performance.mark('render-start');
render();
performance.mark('render-end');
performance.measure('render', 'render-start', 'render-end');
const [m] = performance.getEntriesByName('render');
console.log(m.duration);
// Visible in Chrome DevTools Performance panel.
```
### Frame budget tracker
```javascript
let lastT = performance.now();
function frame(now) {
const dt = now - lastT;
lastT = now;
if (dt > 16.7) console.warn(`slow frame: ${dt.toFixed(1)}ms`);
requestAnimationFrame(frame);
}
requestAnimationFrame(frame);
```
### Cross-origin isolated (max precision)
```http
# Server response headers
Cross-Origin-Opener-Policy: same-origin
Cross-Origin-Embedder-Policy: require-corp
```
```javascript
if (crossOriginIsolated) {
// performance.now() granularity ~5µs
// SharedArrayBuffer 가능
}
```
### POSIX equivalent (C)
```c
#include <time.h>
struct timespec t0, t1;
clock_gettime(CLOCK_MONOTONIC, &t0);
do_work();
clock_gettime(CLOCK_MONOTONIC, &t1);
double elapsed_ns = (t1.tv_sec - t0.tv_sec) * 1e9 + (t1.tv_nsec - t0.tv_nsec);
```
### Rust std (cross-platform)
```rust
use std::time::Instant;
let t0 = Instant::now();
heavy_work();
println!("took {:?}", t0.elapsed()); // sub-ns precision on modern HW
```
### Debounce slow timers
```javascript
// If you measure dt < 0.1ms repeatedly, you're in fuzzed timer mode.
function isolatedPrecisionAvailable() {
const samples = Array.from({length: 100}, () => {
const a = performance.now(); const b = performance.now();
return b - a;
});
return samples.some(d => d > 0 && d < 0.05); // sub-100µs visible
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Wall-clock event log | `Date.now()` / `Date.toISOString()` |
| Profile / micro-bench | `performance.now()` + User Timing |
| Frame loop | rAF callback timestamp (매 monotonic) |
| Audio sync | `AudioContext.currentTime` |
| Cross-origin iframe | postMessage with monotonic delta |
| Native (Linux/macOS) | `clock_gettime(CLOCK_MONOTONIC)` |
| Native (Windows) | `QueryPerformanceCounter` |
**기본값**: Duration 측정엔 매 monotonic. 매 Date 는 user-facing timestamp 만.
## 🔗 Graph
- 변형: [[Long Tasks]]
- 응용: [[Core Web Vitals Optimization (INP, LCP, CLS)|Core Web Vitals]]
- Adjacent: [[Spectre]] · [[Cross-Origin Isolation]] · [[SharedArrayBuffer]]
## 🤖 LLM 활용
**언제**: 성능 측정 코드 작성, profiling, frame budget 분석.
**언제 X**: Persistent timestamp / event log 매 wall-clock 필요 시.
## ❌ 안티패턴
- **`Date.now()` for delta**: NTP step 시 음수 / 점프 가능.
- **`new Date()` 매 hot loop**: allocation cost + ms 한계.
- **Assuming sub-ms precision**: COOP/COEP 없으면 매 1ms rounded.
- **Cross-origin worker timing**: postMessage 의 매 ms 단위 transmit overhead.
- **`setTimeout` 으로 정밀 timing**: 매 4ms+ minimum, jittery.
## 🧪 검증 / 중복
- Verified (W3C HR Time Level 3, MDN performance.now, Chrome timer reduction notes).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — performance.now + Spectre mitigation + COOP/COEP 5µs |
@@ -0,0 +1,186 @@
---
id: wiki-2026-0508-husky
title: Husky
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Husky Git Hooks, husky v9, lint-staged, pre-commit]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [git, hooks, devex, ci, lint-staged]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: javascript
framework: husky-v9
---
# Husky
## 매 한 줄
> **"매 npm-friendly git hooks 의 facto-standard"**. Husky 는 매 `.husky/` directory 안에 매 plain shell script 로 hook 정의 — 매 `git config core.hooksPath` 으로 자동 설정. 매 v9 (2024-2026) 부터 매 거의 zero-config: `npx husky init` → 매 husky/_/h prepare-commit-msg 등 매 wrapper 자동 생성. 매 lint-staged 와의 매 pairing 이 매 표준 setup.
## 매 핵심
### 매 핵심 개념
- **core.hooksPath = .husky/_**: Husky 가 매 이 path 로 git 을 redirect — 매 user 의 매 hook script 와 매 husky framework script 분리.
- **Plain shell**: 매 `.husky/pre-commit` 의 매 첫 line shebang 없이 — Husky v9 가 매 `_/h` wrapper 통해 실행.
- **Skip via env**: `HUSKY=0` 또는 `HUSKY_SKIP_HOOKS=1` — 매 CI 또는 emergency commit.
- **prepare script**: `package.json` 의 `"prepare": "husky"` 가 매 install 시 자동 setup.
### 매 lint-staged 와의 결합
- 매 staged files 만 lint/format → 매 commit 속도 ↑.
- 매 prettier --write + eslint --fix + 매 자동 re-stage.
- 매 large monorepo 에서도 매 fast (only changed paths).
### 매 hook 우선순위 (자주 쓰는)
1. **pre-commit**: lint-staged + type-check (changed only).
2. **commit-msg**: commitlint (Conventional Commits 검증).
3. **pre-push**: full test suite + build smoke.
4. **post-merge**: pnpm install if `package.json` changed.
## 💻 패턴
### Initial setup
```bash
# in repo root
pnpm add -D husky lint-staged
pnpm pkg set scripts.prepare="husky"
pnpm prepare
npx husky init # creates .husky/pre-commit with `npm test` placeholder
```
### .husky/pre-commit (lint-staged + type-check)
```sh
npx lint-staged
pnpm exec tsc --noEmit
```
### lint-staged config (package.json)
```json
{
"lint-staged": {
"*.{ts,tsx,js,jsx}": [
"eslint --fix --max-warnings=0",
"prettier --write"
],
"*.{json,md,yml,yaml}": ["prettier --write"],
"*.css": ["stylelint --fix", "prettier --write"]
}
}
```
### .husky/commit-msg (commitlint)
```sh
npx --no -- commitlint --edit "$1"
```
```js
// commitlint.config.js
module.exports = {
extends: ['@commitlint/config-conventional'],
rules: {
'subject-max-length': [2, 'always', 100],
'scope-enum': [2, 'always', ['ui', 'api', 'docs', 'ci', 'deps']],
},
};
```
### .husky/pre-push (test + build)
```sh
pnpm test --run --silent
pnpm build
```
### Skip in CI / emergency
```bash
# CI: prepare script no-op when not in dev install
# package.json
{
"scripts": {
"prepare": "node -e \"if (process.env.CI) process.exit(0)\" && husky"
}
}
# Emergency commit (use sparingly)
HUSKY=0 git commit -m "hotfix: critical patch"
# or
git commit --no-verify -m "..."
```
### Monorepo: only run hooks if relevant
```sh
# .husky/pre-commit
CHANGED=$(git diff --cached --name-only)
echo "$CHANGED" | grep -q "^apps/web/" && (cd apps/web && pnpm lint-staged)
echo "$CHANGED" | grep -q "^apps/api/" && (cd apps/api && pnpm lint-staged)
```
### Conditional hook based on branch
```sh
# .husky/pre-push
BRANCH=$(git rev-parse --abbrev-ref HEAD)
if [ "$BRANCH" = "main" ]; then
pnpm test --run
pnpm build
else
pnpm test --run --bail=1
fi
```
### Adopt in existing repo
```bash
# After cloning, dependencies need install to run 'prepare'
pnpm install # triggers `prepare` → husky sets core.hooksPath
git config --get core.hooksPath # → .husky/_
```
### Husky + pnpm workspaces filter
```sh
# .husky/pre-commit
STAGED=$(git diff --cached --name-only)
PKGS=$(echo "$STAGED" | awk -F/ '/^packages\// {print $2}' | sort -u)
for p in $PKGS; do
pnpm --filter "@repo/$p" lint-staged
done
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| TS/JS project | Husky v9 + lint-staged |
| Polyglot (Python, Go) | pre-commit framework (multi-lang) |
| Heavy hooks (>10s) | move to pre-push, lighten pre-commit |
| Solo dev hobby | optional — lint in CI alone may suffice |
| Enterprise enforcement | husky + commitlint + branch protection |
**기본값**: 매 TS/JS team — Husky v9 + lint-staged + commitlint.
## 🔗 Graph
- 변형: [[pre-commit]] · [[lefthook]]
- 응용: [[Lint-Staged]] · [[Conventional Commits]]
- Adjacent: [[ESLint]] · [[Prettier]] · [[Biome]]
## 🤖 LLM 활용
**언제**: 매 hook script 작성, lint-staged config 생성, commitlint rule 제안, monorepo conditional logic.
**언제 X**: 매 binary install verification — local 환경에서 매 직접 실행.
## ❌ 안티패턴
- **30s pre-commit**: 매 dev 가 매 --no-verify 습관화 → 매 hook 무용지물.
- **Run full test in pre-commit**: 매 pre-push 로 옮기기.
- **No CI fallback**: 매 hook 만 신뢰 → 매 --no-verify bypass 시 dirty commit.
- **Husky 의 commit hook 안 비밀 커밋 검증 누락**: 매 detect-secrets / gitleaks pairing.
- **Per-developer husky version drift**: 매 lockfile pin 필수.
## 🧪 검증 / 중복
- Verified (Husky v9 docs 2026, lint-staged v15+).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Husky v9 + lint-staged + commitlint patterns |
@@ -0,0 +1,188 @@
---
id: wiki-2026-0508-ifcjs
title: IFCjs
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [That Open Engine, web-ifc, Three.js IFC, BIM viewer]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [bim, ifc, web, three-js, aec, webgl]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: web-ifc-three
---
# IFCjs
## 매 한 줄
> **"매 browser 안의 IFC (Industry Foundation Classes) reader/viewer — 매 BIM 데이터를 매 Three.js scene 으로"**. IFCjs (현재 매 "That Open Engine" 으로 rebrand) 는 매 web-ifc (WASM IFC parser) + 매 Three.js based 매 viewer 의 묶음. 매 AEC (Architecture/Engineering/Construction) 매 web 진입의 standard. 매 2026 현재 매 OpenBIM 운동 의 매 핵심 component.
## 매 핵심
### 매 stack 의 layer
- **web-ifc (C++ → WASM)**: 매 IFC2x3 / IFC4 / IFC4x3 STEP file 의 매 streaming parser.
- **web-ifc-three** (legacy): 매 Three.js mesh 로 변환, property set 추출.
- **@thatopen/components**: 매 modern (2024+) — Three.js 위 UI/tool framework.
- **@thatopen/ui**: 매 web-component 기반 panel/grid/property card.
### 매 IFC 의 본질
- **STEP physical file**: ASCII textual, 매 entity reference graph (`#1=IFCBUILDING(...)`).
- **EXPRESS schema**: 매 IFC4 는 매 1700+ entity types.
- **Geometric representations**: 매 boundary representation, swept solid, CSG, tessellated mesh.
- **Property sets (Psets)**: 매 entity 별 매 metadata bag.
### 매 web vs desktop trade-off
- 매 desktop (Revit, ArchiCAD): full editing, plugin ecosystem.
- 매 web (IFCjs/ThatOpen): zero-install, collaborative review, lightweight viewer.
- 매 hybrid: 매 export IFC from Revit → web viewer.
## 💻 패턴
### Basic IFC viewer (ThatOpen Components 2024+)
```ts
import * as OBC from '@thatopen/components';
import * as THREE from 'three';
const components = new OBC.Components();
const worlds = components.get(OBC.Worlds);
const world = worlds.create<
OBC.SimpleScene, OBC.SimpleCamera, OBC.SimpleRenderer
>();
const container = document.getElementById('app')!;
world.scene = new OBC.SimpleScene(components);
world.renderer = new OBC.SimpleRenderer(components, container);
world.camera = new OBC.SimpleCamera(components);
world.scene.setup();
components.init();
const fragments = components.get(OBC.FragmentsManager);
const ifcLoader = components.get(OBC.IfcLoader);
await ifcLoader.setup();
const file = await fetch('/models/building.ifc');
const buffer = new Uint8Array(await file.arrayBuffer());
const model = await ifcLoader.load(buffer);
world.scene.three.add(model);
```
### Property extraction via web-ifc directly
```ts
import { IfcAPI, IFCWALLSTANDARDCASE } from 'web-ifc';
const api = new IfcAPI();
api.SetWasmPath('/wasm/');
await api.Init();
const data = new Uint8Array(await fetch('/m.ifc').then(r => r.arrayBuffer()));
const modelID = api.OpenModel(data);
const wallIDs = api.GetLineIDsWithType(modelID, IFCWALLSTANDARDCASE);
for (let i = 0; i < wallIDs.size(); i++) {
const id = wallIDs.get(i);
const wall = api.GetLine(modelID, id, true); // recursive expand refs
console.log(wall.GlobalId.value, wall.Name?.value);
}
api.CloseModel(modelID);
```
### Picking + property panel
```ts
const highlighter = components.get(OBC.Highlighter);
highlighter.setup({ world });
highlighter.events.select.onHighlight.add(async (fragmentMap) => {
const indexer = components.get(OBC.IfcRelationsIndexer);
for (const fragId in fragmentMap) {
const expressIDs = [...fragmentMap[fragId]];
for (const id of expressIDs) {
const psets = await indexer.getEntityRelations(model, id, 'IsDefinedBy');
console.log('expressID', id, 'psets', psets);
}
}
});
```
### Convert IFC → fragments (compact binary)
```ts
// fragments are ThatOpen's optimized binary mesh format
const fragmentManager = components.get(OBC.FragmentsManager);
const buffer = fragmentManager.export(model);
await fetch('/upload', { method: 'POST', body: buffer });
```
### Server-side conversion (Node + web-ifc-node)
```ts
import { IfcAPI } from 'web-ifc/web-ifc-api-node';
import { promises as fs } from 'fs';
const api = new IfcAPI();
api.SetWasmPath('node_modules/web-ifc/');
await api.Init();
const buf = await fs.readFile('input.ifc');
const id = api.OpenModel(buf);
const flatMesh = api.LoadAllGeometry(id);
// ... extract triangles, write to glTF
```
### BIM clash detection (rough proxy)
```ts
import { Box3, Vector3 } from 'three';
function findClashes(meshes: THREE.Mesh[]) {
const boxes = meshes.map(m => {
const b = new Box3().setFromObject(m);
return { box: b, mesh: m };
});
const clashes: [THREE.Mesh, THREE.Mesh][] = [];
for (let i = 0; i < boxes.length; i++)
for (let j = i + 1; j < boxes.length; j++)
if (boxes[i].box.intersectsBox(boxes[j].box))
clashes.push([boxes[i].mesh, boxes[j].mesh]);
return clashes;
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Web-only IFC viewer | ThatOpen Components |
| Server-side IFC parsing | web-ifc-node |
| Property extraction only | web-ifc API directly |
| Heavy editing | desktop (Revit) export |
| Massive models (>1GB) | fragments format + tile streaming |
| Clash detection on web | use AABB pre-filter + GPU mesh-mesh |
**기본값**: 매 modern AEC web app — ThatOpen Components + fragments.
## 🔗 Graph
- 응용: [[Digital Twin]]
- Adjacent: [[Three.js]]
## 🤖 LLM 활용
**언제**: IFC entity 의 mapping 설명 (IFC → glTF), property set 매 자연어 query, 매 UI panel scaffold.
**언제 X**: 매 large IFC parsing performance 최적화 — 매 measure 매 직접.
## ❌ 안티패턴
- **Loading 1GB IFC into browser memory directly**: 매 OOM — 매 fragments + streaming 사용.
- **Recursive GetLine on every entity**: 매 N² — 매 IfcRelationsIndexer 사용.
- **Treating IFC as glTF**: 매 IFC 는 매 graph + semantics, 매 mesh-only X.
- **No coordinate system handling**: 매 IFC 의 IfcSite localPlacement 무시 → 매 wrong global pos.
- **Missing wasm path**: 매 web-ifc 의 매 WASM file 의 매 hosting failure — `SetWasmPath` 명시.
## 🧪 검증 / 중복
- Verified (ThatOpen Engine docs 2026, web-ifc GitHub).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — IFC stack + ThatOpen Components patterns |
@@ -0,0 +1,182 @@
---
id: wiki-2026-0508-incremental-build
title: Incremental Build
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Incremental Compilation, Cached Build, Build Cache]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [build, ci, performance, monorepo, caching]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: turborepo
---
# Incremental Build
## 매 한 줄
> **"매 변경된 파일 + downstream 의존성만 rebuild — 매 hash-based caching 의 핵심"**. 매 1979 Make 의 mtime-based 시작, 매 2026 Turborepo/Nx/Bazel 의 content-addressed cache 가 default — 매 monorepo 에서 100x speedup 흔함.
## 매 핵심
### 매 작동 원리
- **Input hash**: 매 source files + deps + env → SHA256.
- **Cache key**: hash → output artifacts (dist/, .d.ts).
- **Hit**: cache 존재 → restore, skip work.
- **Miss**: rebuild, store.
### 매 granularity
- **File-level**: tsc --incremental (.tsbuildinfo).
- **Task-level**: Turborepo (per-package).
- **Action-level**: Bazel (per-rule, hermetic).
### 매 응용
1. Monorepo CI: 매 affected package 만 test.
2. Local dev: watch mode, 매 sub-second rebuild.
3. Docker: layer caching = path 별 invalidation.
## 💻 패턴
### Turborepo pipeline
```json
// turbo.json
{
"$schema": "https://turbo.build/schema.json",
"globalDependencies": ["tsconfig.base.json"],
"tasks": {
"build": {
"dependsOn": ["^build"],
"inputs": ["src/**", "package.json", "tsconfig.json"],
"outputs": ["dist/**", ".next/**"],
"cache": true
},
"test": {
"dependsOn": ["build"],
"inputs": ["src/**", "test/**"],
"outputs": ["coverage/**"]
},
"lint": { "cache": true, "outputs": [] }
},
"remoteCache": { "signature": true }
}
```
### TypeScript incremental
```json
// tsconfig.json
{
"compilerOptions": {
"incremental": true,
"tsBuildInfoFile": ".cache/tsbuild.json",
"composite": true,
"declaration": true,
"declarationMap": true
},
"references": [
{ "path": "../core" },
{ "path": "../utils" }
]
}
```
### Nx affected
```bash
# Only test packages affected by changes since main
nx affected --target=test --base=origin/main --head=HEAD --parallel=4
# Print affected graph
nx graph --affected --base=origin/main
```
### Vite HMR (sub-second)
```ts
// vite.config.ts
import { defineConfig } from 'vite';
export default defineConfig({
server: {
hmr: { overlay: true },
watch: { usePolling: false, ignored: ['**/node_modules/**', '**/dist/**'] }
},
build: {
rollupOptions: { cache: true }
},
cacheDir: '.cache/vite'
});
```
### GitHub Actions remote cache
```yaml
- uses: actions/cache@v4
with:
path: |
.turbo
node_modules/.cache
key: turbo-${{ runner.os }}-${{ hashFiles('**/pnpm-lock.yaml') }}-${{ github.sha }}
restore-keys: turbo-${{ runner.os }}-${{ hashFiles('**/pnpm-lock.yaml') }}-
- run: pnpm turbo run build test --cache-dir=.turbo
```
### Bazel hermetic action
```python
# BUILD.bazel
load("@npm//@bazel/typescript:index.bzl", "ts_project")
ts_project(
name = "core",
srcs = glob(["src/**/*.ts"]),
declaration = True,
incremental = True,
deps = ["//packages/utils"],
)
```
### Cache hit ratio metric
```ts
// scripts/cache-stats.ts
import { execSync } from 'node:child_process';
const out = execSync('turbo run build --dry=json').toString();
const tasks = JSON.parse(out).tasks;
const hits = tasks.filter((t: any) => t.cache.status === 'HIT').length;
console.log(`cache hit: ${hits}/${tasks.length} = ${(hits/tasks.length*100).toFixed(1)}%`);
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Monorepo 10+ packages | Turborepo or Nx |
| Strict reproducibility | Bazel (hermetic) |
| Single TS app | tsc --incremental + Vite |
| Docker images | BuildKit + multi-stage layer cache |
**기본값**: 매 Turborepo + remote cache (Vercel or self-hosted).
## 🔗 Graph
- 부모: [[Continuous Integration]]
- 응용: [[CI_CD_Pipeline]]
- Adjacent: [[Dependency Graph]]
## 🤖 LLM 활용
**언제**: 매 turbo.json/nx.json 의 generation, cache key tuning 추천.
**언제 X**: 매 Bazel hermetic rule — 매 strict, LLM hallucination 위험.
## ❌ 안티패턴
- **Time-based keys**: `date +%s` cache key — 매 hit 0%.
- **Untracked inputs**: env var, system clock 의존 → false hit.
- **Cache everything**: lint output 까지 cache → debugging 의 hell.
- **No remote cache**: CI 매 fresh 시작 → local-only 의 무의미.
## 🧪 검증 / 중복
- Verified (Turborepo 2.x, Nx 20+, Bazel 7+ 공식 docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — incremental build 의 hash caching 정리 |
@@ -0,0 +1,156 @@
---
id: wiki-2026-0508-inferential-statistics
title: Inferential Statistics
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Statistical Inference, Hypothesis Testing, Confidence Intervals]
duplicate_of: none
source_trust_level: A
confidence_score: 0.92
verification_status: applied
tags: [statistics, inference, hypothesis-testing, ab-testing, sre]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: scipy
---
# Inferential Statistics
## 매 한 줄
> **"매 sample → population parameter 의 추정 + uncertainty 의 quantify"**. 매 1900s Fisher, Neyman, Pearson 의 frequentist framework, 매 2026 A/B test, SRE alerting, ML evaluation 의 backbone — Bayesian + bootstrap 의 modern hybrid 가 default.
## 매 핵심
### 매 Frequentist vs Bayesian
- **Frequentist**: parameter fixed, data random. p-value, CI.
- **Bayesian**: parameter random (prior), data fixed. Posterior, credible interval.
- **Bootstrap**: distribution-free, resample n→inf 시뮬레이션.
### 매 Test 분류
- **Parametric**: t-test, ANOVA, Z-test (assumes normal).
- **Non-parametric**: Mann-Whitney U, Kruskal-Wallis, permutation.
- **Sequential**: Always Valid Inference, mSPRT (peek-safe).
### 매 응용
1. A/B test: conversion lift 측정.
2. SRE: SLO breach 의 statistical significance.
3. ML: model A vs B 의 holdout 비교.
## 💻 패턴
### Two-sample t-test
```python
import scipy.stats as st
control = [12, 14, 11, 13, 12, 15, 13]
treat = [16, 18, 15, 17, 19, 16, 18]
res = st.ttest_ind(control, treat, equal_var=False)
print(f"t={res.statistic:.3f} p={res.pvalue:.4f}")
ci = res.confidence_interval(0.95)
print(f"95% CI: [{ci.low:.2f}, {ci.high:.2f}]")
```
### Bootstrap CI
```python
import numpy as np
def bootstrap_mean_ci(x, n=10_000, alpha=0.05):
rng = np.random.default_rng(42)
boots = rng.choice(x, size=(n, len(x)), replace=True).mean(axis=1)
return np.quantile(boots, [alpha/2, 1-alpha/2])
ci = bootstrap_mean_ci(np.array(control))
print(f"Bootstrap 95% CI: {ci}")
```
### Sample size calculation (power)
```python
from statsmodels.stats.power import TTestIndPower
analysis = TTestIndPower()
n = analysis.solve_power(effect_size=0.3, power=0.8, alpha=0.05)
print(f"매 group 당 n = {int(np.ceil(n))}")
```
### Sequential test (mSPRT, peek-safe)
```python
import numpy as np
def msprt_log_likelihood(x, mu0=0, sigma=1, theta=0.1):
n = len(x); xbar = np.mean(x); v = sigma**2
tau2 = theta**2
log_bf = 0.5*np.log(v/(v+n*tau2)) + (n**2 * (xbar-mu0)**2 * tau2) / (2*v*(v+n*tau2))
return log_bf # > log(1/alpha) 매 reject H0
```
### Bayesian A/B (PyMC)
```python
import pymc as pm
with pm.Model() as m:
p_a = pm.Beta("p_a", 1, 1)
p_b = pm.Beta("p_b", 1, 1)
pm.Binomial("y_a", n=10_000, p=p_a, observed=520)
pm.Binomial("y_b", n=10_000, p=p_b, observed=580)
diff = pm.Deterministic("diff", p_b - p_a)
idata = pm.sample(2000, chains=4, random_seed=42)
print(f"P(B > A) = {(idata.posterior['diff'] > 0).mean().item():.3f}")
```
### Permutation test
```python
def permutation_test(a, b, n=10_000):
diff_obs = np.mean(a) - np.mean(b)
pool = np.concatenate([a, b])
rng = np.random.default_rng(0)
diffs = []
for _ in range(n):
rng.shuffle(pool)
diffs.append(np.mean(pool[:len(a)]) - np.mean(pool[len(a):]))
return np.mean(np.abs(diffs) >= abs(diff_obs))
```
### SRE: Welch's test on latency p99
```python
# 매 deploy 전후 latency p99 비교
from scipy.stats import ttest_ind
before_p99 = np.array([124, 130, 128, 132, 125]) # ms
after_p99 = np.array([142, 138, 145, 140, 144])
t, p = ttest_ind(before_p99, after_p99, equal_var=False)
if p < 0.01: print("매 regression detected — rollback")
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Fixed-N A/B | t-test or chi-squared |
| Continuous monitoring | mSPRT or always-valid CI |
| Small N, non-normal | Bootstrap or permutation |
| Multi-arm + prior | Bayesian (Beta-Binomial) |
**기본값**: Bootstrap CI + sequential test 의 production A/B.
## 🔗 Graph
- 부모: [[Statistics & Data Analysis]] · [[Probability Theory]]
- 변형: [[Bayesian_Inference|Bayesian Inference]]
- 응용: [[SRE]] · [[Anomaly-Detection]]
- Adjacent: [[Type 1 vs Type 2 Errors]] · [[Power Analysis]]
## 🤖 LLM 활용
**언제**: test 선택 의 advice (data shape → test type), 의 result interpretation.
**언제 X**: 매 multiple-comparison correction 매 자동화 X — domain knowledge 필요.
## ❌ 안티패턴
- **p-hacking**: 매 multiple test 후 cherry-pick.
- **Peeking**: fixed-N test 의 매 day 확인 → α inflation.
- **Single point**: CI 매 보고 안하고 mean 만.
- **N=∞ → significance ≠ effect size**: Cohen's d 도 같이.
## 🧪 검증 / 중복
- Verified (Casella & Berger "Statistical Inference", scipy/statsmodels docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — frequentist + Bayesian + sequential pattern |
@@ -0,0 +1,150 @@
---
id: wiki-2026-0508-information-society
title: Information Society
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Post-Industrial Society, Network Society, Knowledge Economy]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [society, sociology, internet, economy, policy]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: na
framework: na
---
# Information Society
## 매 한 줄
> **"매 information 의 production · distribution · consumption 의 dominant economic activity 의 society"**. 매 Bell (1973) 의 post-industrial 의 prediction 의 Castells (1996) 의 network society 의 elaboration 의 2026 년 의 LLM 의 cognitive labor 의 partial automation 의 phase 의 entry. 매 attention economy + algorithmic curation + AI 의 mediation 의 defining traits.
## 매 핵심
### 매 phase
1. **Industrial (1800-1970)**: 매 goods + capital.
2. **Post-industrial (1970-2000)**: 매 service + knowledge worker.
3. **Network society (2000-2020)**: 매 internet, platform, social media.
4. **AI-mediated (2020-)**: 매 algorithmic curation + LLM 의 cognitive labor automation.
### 매 핵심 dynamics
- **Attention as scarce resource** (Simon 1971).
- **Network effects** — value ∝ users² (Metcalfe).
- **Power-law distribution** — winner-take-most (rich-get-richer).
- **Surveillance capitalism** (Zuboff 2019) — behavioral data 의 commodification.
### 매 응용 / 영향
1. Platform economy (Uber, Airbnb).
2. Filter bubble + algorithmic polarization.
3. Digital divide (access inequality).
4. AI-driven labor displacement (knowledge work).
5. Misinformation / generative content flood.
## 💻 패턴
### Network effect simulation
```python
import numpy as np
def network_value(n_users, type='metcalfe'):
"""Value of a network as users grow."""
if type == 'sarnoff': return n_users # broadcast
if type == 'metcalfe': return n_users ** 2 # peer-to-peer
if type == 'reed': return 2 ** n_users # group-forming
raise ValueError(type)
# Implication: marginal user adds disproportionate value
# → winner-take-most platform dynamics
```
### Power-law follower distribution
```python
# Most social platforms: Pareto / Zipf distribution
import numpy as np
import matplotlib.pyplot as plt
n_users = 1_000_000
followers = np.random.zipf(a=1.5, size=n_users)
# top 1% holds ~50%+ of total reach
top_1pct = np.sort(followers)[-n_users // 100:].sum() / followers.sum()
print(f"Top 1% share: {top_1pct:.1%}")
```
### Filter-bubble simulator (echo chamber)
```python
def update_belief(belief, exposed_content, alpha=0.1):
# users see content aligned with their belief (algo-curated)
aligned = [c for c in exposed_content if abs(c - belief) < 0.3]
if aligned:
belief += alpha * (np.mean(aligned) - belief)
return belief
# Over many iterations → polarization (variance ↑, mean clusters)
```
### Attention-economy revenue model
```python
def ad_revenue(daus, sessions_per_day, ads_per_session, cpm):
impressions = daus * sessions_per_day * ads_per_session
return impressions / 1000 * cpm
# Engagement-maximization → outrage / novelty → societal externalities
```
### Digital-divide index
```python
def digital_divide_score(country):
return 0.4 * country.broadband_penetration + \
0.3 * country.literacy_rate + \
0.2 * country.smartphone_penetration + \
0.1 * country.ai_tool_access
```
### LLM-mediated labor share (2026)
```python
# Productivity uplift studies (Brynjolfsson 2024, etc.)
def cognitive_task_time_with_llm(baseline_hours, task_type):
uplift = {
'writing': 0.40, 'coding': 0.55, 'research': 0.30,
'creative_strategy': 0.20, 'manual': 0.0
}
return baseline_hours * (1 - uplift.get(task_type, 0))
```
## 매 결정 기준
| 상황 | Lens |
|---|---|
| Platform design | Network effects + power-law dynamics |
| Content policy | Attention economy externalities |
| Public policy | Digital divide + labor displacement |
| Org strategy | Knowledge worker + AI augmentation |
| Civic discourse | Filter bubble + misinformation |
**기본값**: 매 multi-lens — 매 single theory 의 over-generalize 의 risk.
## 🔗 Graph
- 변형: [[Network Society]]
## 🤖 LLM 활용
**언제**: 매 frame analysis, multi-perspective synthesis. 매 tech-policy intersection 의 explanation.
**언제 X**: 매 country-specific 의 latest stat 은 fact-check. 매 LLM 의 stale 의 risk.
## ❌ 안티패턴
- **Tech-determinist 의 simplification**: 매 society shapes tech 의 too. 매 reciprocal.
- **Single-metric (GDP, DAU) 의 over-reliance**: 매 well-being externality 의 miss.
- **AI = neutral 의 assumption**: 매 X. 매 training data + deployment context 의 bias 의 carry.
## 🧪 검증 / 중복
- Verified (Bell 1973, Castells 1996, Zuboff 2019, Brynjolfsson 2024).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — network society + AI-mediated phase synthesis |
@@ -0,0 +1,157 @@
---
id: wiki-2026-0508-instancedmesh2
title: InstancedMesh2
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [three-instanced-mesh2, three.js-instancedmesh2]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [three.js, webgl, performance, instancing, rendering]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: three.js
---
# InstancedMesh2
## 매 한 줄
> **"매 InstancedMesh의 진화형 — frustum culling, LOD, BVH, per-instance uniforms를 그대로 지원하는 instancing 솔루션"**. 매 three.js의 stock InstancedMesh가 모든 instance를 ALWAYS draw 하는 한계를 극복하기 위해 등장한 community library — agargaro/instanced-mesh가 매 2024-2026 사실상 표준으로 자리잡음.
## 매 핵심
### 매 stock InstancedMesh의 한계
- 매 frustum culling 부재 → off-screen instance도 GPU에 commit
- 매 per-instance visibility toggle 부재
- 매 LOD 미지원 — 매 distance 무관 동일 mesh draw
- 매 raycasting brute-force — 매 매 instance 매 triangle scan
### 매 InstancedMesh2 추가 기능
- **Per-instance frustum culling**: 매 BVH 기반 fast cull
- **LOD groups**: 매 distance threshold 별 다른 geometry
- **BVH acceleration**: 매 raycast O(log n)
- **Per-instance uniforms**: 매 색상/sprite frame/animation time 등
- **Shadow culling**: 매 shadow camera frustum 별도 cull
### 매 응용
1. 매 RTS/시뮬레이션 — 매 1k+ unit 매 60fps.
2. 매 archviz — 매 forest/도시 scenery instance.
3. 매 particle alternative — 매 mesh-particle hybrid.
## 💻 패턴
### 매 기본 setup
```typescript
import { InstancedMesh2 } from '@three.ez/instanced-mesh';
import * as THREE from 'three';
const geo = new THREE.BoxGeometry(1, 1, 1);
const mat = new THREE.MeshStandardMaterial();
const count = 10_000;
const mesh = new InstancedMesh2(geo, mat, { capacity: count });
mesh.addInstances(count, (obj, idx) => {
obj.position.set(
(Math.random() - 0.5) * 200,
0,
(Math.random() - 0.5) * 200,
);
obj.color = new THREE.Color(Math.random(), Math.random(), Math.random());
});
mesh.computeBVH();
scene.add(mesh);
```
### 매 LOD groups
```typescript
const lod = new InstancedMesh2(geoHigh, mat, { capacity: 5000 });
lod.addLOD(geoMid, mat, 30); // 30 units 부터 mid mesh
lod.addLOD(geoLow, mat, 100); // 100 units 부터 low mesh
lod.addShadowLOD(geoShadow, 50); // shadow 용 별도 LOD
```
### 매 per-instance update
```typescript
mesh.updateInstances((obj, idx) => {
obj.position.y = Math.sin(time + idx * 0.1);
obj.rotation.y += 0.01;
});
```
### 매 frustum culling toggle
```typescript
mesh.perObjectFrustumCulled = true; // default
mesh.sortObjects = true; // 매 transparent 매 back-to-front
```
### 매 raycasting BVH
```typescript
mesh.computeBVH({ margin: 0 });
const ray = new THREE.Raycaster();
ray.setFromCamera(mouse, camera);
const hits = ray.intersectObject(mesh);
// hits[0].instanceId 매 정확한 instance
```
### 매 instance 제거
```typescript
mesh.removeInstances([0, 5, 10]); // 매 batch 매 1 frame
mesh.computeBVH(); // 매 dirty 면 rebuild
```
### 매 color attribute
```typescript
mesh.setColorAt(idx, new THREE.Color('red'));
mesh.instanceColor.needsUpdate = true;
```
### 매 shader integration
```typescript
mat.onBeforeCompile = (shader) => {
shader.vertexShader = shader.vertexShader.replace(
'#include <begin_vertex>',
`#include <begin_vertex>
transformed += instanceMatrix[3].xyz * 0.01;`
);
};
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| <500 instance | 매 stock InstancedMesh |
| 1k-100k 매 same geometry | InstancedMesh2 |
| 매 different geometries | BatchedMesh |
| 매 GPU-driven 매 indirect | 매 custom WebGPU |
**기본값**: 매 1k 이상 instance — InstancedMesh2.
## 🔗 Graph
- 부모: [[InstancedMesh]] · [[three.js]]
- 변형: [[BatchedMesh]] · [[three-mesh-bvh]]
- 응용: [[Frustum Culling]] · [[Draw Call]]
- Adjacent: [[BVH]] · [[Raycasting|Raycaster]]
## 🤖 LLM 활용
**언제**: 매 large-scale 동일 mesh scene — vegetation, crowd, debris.
**언제 X**: 매 instance 별 geometry 다름 — BatchedMesh 사용.
## ❌ 안티패턴
- **BVH 매 update 안 함**: 매 instance 이동 후 raycast 부정확.
- **capacity 매 너무 크게**: 매 GPU memory 매 낭비.
- **per-frame full update**: 매 dirty flag 만 flush.
## 🧪 검증 / 중복
- Verified (@three.ez/instanced-mesh v0.4+, three.js r170+).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — InstancedMesh2 라이브러리 사용법 + LOD/BVH 패턴 정리 |
@@ -0,0 +1,184 @@
---
id: wiki-2026-0508-inversion
title: Inversion
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Inversion of Control, Invert Thinking, Negative Visualization]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [thinking-model, ioc, di, mental-model, design]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: nestjs
---
# Inversion
## 매 한 줄
> **"매 problem 의 reverse 매 stating — '매 fail 하는 방법' 의 enumerate, '매 control 의 누가 가지나' 의 flip"**. 매 Carl Jacobi "invert, always invert", 매 Charlie Munger 의 mental model, 매 software IoC/DI 의 design principle.
## 매 핵심
### 매 Inversion 3 layer
- **Cognitive**: "매 success" 대신 "매 failure 의 path" 을 enumerate.
- **Architectural (IoC)**: caller 가 control 하던 것을 framework 가 control.
- **Dependency (DI)**: hard-coded `new Foo()` 대신 inject.
### 매 IoC 의 forms
- **DI**: constructor/setter inject.
- **Service Locator**: registry lookup.
- **Events/Hooks**: publish-subscribe.
- **Template Method**: framework 의 skeleton, user 의 fill-in.
### 매 응용
1. Design review: failure mode enumeration.
2. Testability: mock injection.
3. Decision making: 매 worst case 의 list, 매 avoid.
## 💻 패턴
### NestJS DI
```ts
@Injectable()
export class UserRepo {
findById(id: string) { /* ... */ }
}
@Injectable()
export class UserService {
// 매 instance 매 직접 만들지 않음 — framework 의 inject
constructor(private readonly repo: UserRepo) {}
async profile(id: string) { return this.repo.findById(id); }
}
@Module({ providers: [UserRepo, UserService], exports: [UserService] })
export class UserModule {}
```
### Manual DI (no framework)
```ts
type Deps = { db: Database; cache: Cache; logger: Logger };
export const makeUserService = ({ db, cache, logger }: Deps) => ({
async findById(id: string) {
const cached = await cache.get(id);
if (cached) return cached;
logger.debug('cache miss', id);
return db.users.findUnique({ where: { id } });
}
});
```
### Premortem (failure inversion)
```ts
// scripts/premortem.ts
const failureModes = [
{ mode: 'DB connection lost', mitigation: 'retry + circuit breaker' },
{ mode: 'Cache stampede', mitigation: 'singleflight + jitter' },
{ mode: 'Memory leak in handler', mitigation: 'memray weekly + RSS alert' },
{ mode: 'Auth token expired mid-flow', mitigation: 'refresh interceptor' }
];
console.table(failureModes);
```
### Test seam via inversion
```ts
// 매 hard-coded fetch 대신 inject — testable
type Fetcher = (url: string) => Promise<Response>;
export const makeApi = (fetcher: Fetcher = fetch) => ({
async get(path: string) {
const r = await fetcher(`https://api.acme.com${path}`);
return r.json();
}
});
// test
const fakeFetch: Fetcher = async () => new Response(JSON.stringify({ ok: true }));
expect(await makeApi(fakeFetch).get('/x')).toEqual({ ok: true });
```
### Hook-based extension (template inversion)
```ts
// framework 의 lifecycle, user 의 hook 의 plug
type Plugin = {
beforeRequest?: (req: Request) => Request;
afterResponse?: (res: Response) => Response;
};
export class Server {
private plugins: Plugin[] = [];
use(p: Plugin) { this.plugins.push(p); }
async handle(req: Request) {
for (const p of this.plugins) req = p.beforeRequest?.(req) ?? req;
let res = await this.process(req);
for (const p of this.plugins) res = p.afterResponse?.(res) ?? res;
return res;
}
}
```
### Inverted error handling (Result type)
```ts
// 매 throw 대신 매 return 으로 invert — caller 의 forced handle
type Result<T, E = Error> = { ok: true; value: T } | { ok: false; error: E };
export async function fetchUser(id: string): Promise<Result<User>> {
try {
const u = await db.users.findUniqueOrThrow({ where: { id } });
return { ok: true, value: u };
} catch (e) {
return { ok: false, error: e as Error };
}
}
```
### Decision premortem prompt
```ts
// 매 launch 전 self-question
const premortem = `
1. 매 launch 6 month 후, 이 기능 매 fail 했다고 가정.
2. 매 가장 가능한 5 failure cause 매 무엇?
3. 매 매 cause 의 mitigation 매 무엇?
`;
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Module 매 testable 만들기 | DI |
| Framework 의 design | IoC + plugin hooks |
| Decision making | Premortem (failure inversion) |
| Error handling | Result type (return invert) |
**기본값**: constructor DI + premortem 매 architecture review 시.
## 🔗 Graph
- 부모: [[Mental_Models|Mental Models]] · [[Software Design Principles]]
- 변형: [[Dependency Injection]] · [[Inversion of Control]]
- 응용: [[NestJS]] · [[Result Type]]
- Adjacent: [[Encapsulation-via-Access-Modifiers]] · [[Testability]]
## 🤖 LLM 활용
**언제**: 매 design 의 failure mode 의 brainstorm, IoC refactor 의 candidate 식별.
**언제 X**: 매 trivial pure function 의 매 over-DI X — 매 simplicity 가 우선.
## ❌ 안티패턴
- **DI everywhere**: simple value 도 inject → 매 boilerplate explosion.
- **Service locator hell**: global registry 의 hidden dependency.
- **No premortem**: 매 ship 후에야 매 failure 발견.
- **Inversion theater**: interface 매 single impl 만 — 의 wrap 의 무의미.
## 🧪 검증 / 중복
- Verified (Charlie Munger "Poor Charlie's Almanack", Martin Fowler "IoC Containers").
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — cognitive + IoC + DI inversion 통합 |
@@ -0,0 +1,169 @@
---
id: wiki-2026-0508-issue-001-combat-reference-error
title: Issue 001 Combat Reference Error Troubleshooting
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Reference Error Debugging, Runtime Reference Error]
duplicate_of: none
source_trust_level: B
confidence_score: 0.85
verification_status: applied
tags: [debugging, reference-error, runtime, troubleshooting, combat-system]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: nodejs
---
# Issue 001 Combat Reference Error Troubleshooting
## 매 한 줄
> **"매 ReferenceError 의 root cause 매 hoisting, TDZ, circular import, async timing 의 4 가지로 collapse"**. 매 case study (combat system 의 reference error) 를 통해 매 systematic debug pipeline 정리.
## 매 핵심
### 매 ReferenceError 4 카테고리
- **Undeclared**: variable 매 declare 안됨 (typo, missing import).
- **TDZ**: `let`/`const` 매 init 전 access (temporal dead zone).
- **Circular import**: A imports B, B imports A → 매 partially-loaded module.
- **Async timing**: top-level await, dynamic import 의 race.
### 매 Combat case (post-mortem 요약)
- **Symptom**: `ReferenceError: CombatEngine is not defined` 매 production only.
- **Root cause**: Vite tree-shaking 의 side-effect import 의 elimination.
- **Fix**: `package.json` 의 `"sideEffects": ["./src/combat/registry.ts"]`.
### 매 Debug 절차
1. Reproduce: minimal repo.
2. Stack trace: 매 first frame 의 file:line.
3. Bisect: git bisect or feature flag.
4. Verify: regression test 추가.
## 💻 패턴
### TDZ 의 detection
```ts
// BAD — TDZ
console.log(x); // ReferenceError
let x = 1;
// GOOD — declare 먼저
let x: number;
x = 1;
console.log(x);
```
### Circular import resolve
```ts
// a.ts
import { B } from './b';
export class A { b = new B(); }
// b.ts — circular
// import { A } from './a'; // 매 X
// 매 type-only import 로 break:
import type { A } from './a';
export class B { parent?: A; }
```
### Vite sideEffects 의 protect
```json
// package.json
{
"sideEffects": [
"./src/combat/registry.ts",
"./src/polyfills/*.ts",
"*.css"
]
}
```
### Webpack module federation 의 안전한 dynamic
```ts
const Combat = await import(/* webpackChunkName: "combat" */ './combat')
.catch(err => {
console.error('Combat module failed', err);
return { CombatEngine: class FallbackEngine {} };
});
```
### Stack trace parser
```ts
function parseRefError(err: Error): { name: string; file?: string; line?: number } {
const m = err.message.match(/(\w+) is not defined/);
const frame = err.stack?.split('\n')[1]?.match(/at .* \((.+):(\d+):\d+\)/);
return {
name: m?.[1] ?? 'unknown',
file: frame?.[1],
line: frame ? Number(frame[2]) : undefined
};
}
```
### Regression test
```ts
import { describe, it, expect } from 'vitest';
import { CombatEngine } from '@/combat';
describe('combat module loading', () => {
it('exports CombatEngine after tree-shake', () => {
expect(CombatEngine).toBeDefined();
expect(typeof CombatEngine).toBe('function');
});
it('registry has registered abilities', async () => {
const { abilityRegistry } = await import('@/combat/registry');
expect(abilityRegistry.size).toBeGreaterThan(0);
});
});
```
### Sentry breadcrumb 의 capture
```ts
import * as Sentry from '@sentry/node';
Sentry.init({
beforeSend(event, hint) {
if (hint.originalException instanceof ReferenceError) {
event.tags = { ...event.tags, error_class: 'reference' };
}
return event;
}
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| TDZ 의 의심 | 매 declaration 위치 의 audit |
| Circular import | type-only import or DI |
| Tree-shake elimination | sideEffects 명시 |
| Async race | top-level await guard |
**기본값**: 매 minimal repro → bisect → regression test 의 add.
## 🔗 Graph
- 부모: [[Debugger_Techniques]]
- Adjacent: [[Source Maps]] · [[Sentry]]
## 🤖 LLM 활용
**언제**: stack trace + module graph paste → root cause hypothesis.
**언제 X**: 매 production memory dump 매 직접 read X — local repro 가 우선.
## ❌ 안티패턴
- **Catch and ignore**: `try { ... } catch {}` — error 매 silently 사라짐.
- **No regression test**: fix 후 test 매 추가 X → 매 regression repeat.
- **Random side-effect import**: `import './magic'` — tree-shake 가 죽임.
- **Production-only debug**: local 매 repro 안하고 prod 에서 console.log.
## 🧪 검증 / 중복
- Verified (MDN ReferenceError, Vite tree-shake docs).
- 신뢰도 B (case-specific 의 detail).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — ReferenceError 의 4 카테고리 + combat case |
@@ -0,0 +1,146 @@
---
id: wiki-2026-0508-jpeg-xl
title: JPEG XL
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [jxl, jpeg-xl-format]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [image-format, compression, web-performance, codec]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C++
framework: libjxl
---
# JPEG XL
## 매 한 줄
> **"매 royalty-free 차세대 image codec — 매 lossless JPEG transcoding + better-than-AVIF lossy"**. 매 ISO/IEC 18181 — 매 Cloudinary/Google이 design — 매 Safari 17+ 가 매 native 지원 — 매 2026 점진적 mainstream — 매 JPEG의 정신적 후계자.
## 매 핵심
### 매 차별점
- **lossless JPEG re-compress**: 매 기존 JPEG 의 평균 20% 매 추가 절감, 매 100% 매 reversible.
- **wide gamut + HDR**: 매 BT.2100, PQ/HLG, alpha, animation.
- **progressive decode**: 매 stream-as-you-go.
- **CPU efficient**: 매 AVIF 보다 encode 매 빠름.
### 매 brower support (2026)
- Safari 17+: native.
- Chrome: behind flag — 매 unflag 검토 중.
- Firefox: nightly flag.
- 매 polyfill: jxl.js (WASM).
### 매 응용
1. 매 photography archive 의 size 의 줄임.
2. 매 CDN의 multi-format negotiation (jxl > avif > webp > jpeg).
3. 매 raw → web pipeline의 매 single-format 통일.
## 💻 패턴
### 매 cjxl encode
```bash
cjxl input.png output.jxl -q 90 --effort 7
# 매 distance 0.5-3.0 매 매우 high quality
cjxl input.jpg out.jxl --lossless_jpeg=1 # 매 JPEG → JXL 매 lossless
```
### 매 djxl decode
```bash
djxl out.jxl out.png
djxl out.jxl out.jpg --jpeg_jxl_to_jpeg # 매 원본 JPEG bit-exact 복원
```
### 매 sharp (Node.js)
```javascript
import sharp from 'sharp';
await sharp('photo.jpg')
.jxl({ quality: 85, effort: 7 })
.toFile('photo.jxl');
```
### 매 HTTP content negotiation
```nginx
map $http_accept $img_ext {
~image/jxl ".jxl";
~image/avif ".avif";
~image/webp ".webp";
default ".jpg";
}
location /img/ {
try_files $uri$img_ext $uri =404;
}
```
### 매 picture element
```html
<picture>
<source type="image/jxl" srcset="hero.jxl">
<source type="image/avif" srcset="hero.avif">
<source type="image/webp" srcset="hero.webp">
<img src="hero.jpg" alt="hero">
</picture>
```
### 매 polyfill (WASM)
```html
<script type="module">
import { decode } from 'https://unpkg.com/@jsquash/jxl';
const buf = await fetch('photo.jxl').then(r => r.arrayBuffer());
const imageData = await decode(buf);
ctx.putImageData(imageData, 0, 0);
</script>
```
### 매 batch transcode
```bash
fd -e jpg . | parallel -j8 'cjxl {} {.}.jxl --lossless_jpeg=1'
```
### 매 quality tuning
```bash
# 매 distance 매 lower = better quality
# 매 1.0 매 visually lossless 의 일반적 target
cjxl in.png out.jxl -d 1.0 -e 7
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 archival JPEG | 매 lossless JXL transcode |
| 매 web photo modern | 매 JXL + AVIF fallback |
| 매 universal 호환 | 매 JPEG/WebP 의 유지 |
| 매 HDR/wide gamut | 매 JXL or AVIF |
**기본값**: 매 archival lossless transcode + web 의 multi-format negotiation.
## 🔗 Graph
- 부모: [[Web Performance]]
- 변형: [[AVIF]]
- 응용: [[CDN]] · [[Page Experience Algorithm]]
- Adjacent: [[Tree Shaking (번들 크기 최적화)]]
## 🤖 LLM 활용
**언제**: 매 archive 매 size 의 reduce 매 reversible 요구.
**언제 X**: 매 universal browser support 가 hard requirement.
## ❌ 안티패턴
- **JPEG → JXL → JPEG quality 매 lossy**: 매 `--lossless_jpeg=1` 의 잊음.
- **only JXL serve**: 매 Chrome user 매 broken image.
- **--effort 9 매 production encode**: 매 CPU 의 30x.
## 🧪 검증 / 중복
- Verified (libjxl 0.10+, ISO/IEC 18181, Safari 17+).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — JPEG XL 인코딩/디코딩/HTTP negotiation 정리 |
@@ -0,0 +1,132 @@
---
id: wiki-2026-0508-joern
title: Joern
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [joern-cpg, code-property-graph-tool]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, sast, cpg, static-analysis, vulnerability]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Scala
framework: ShiftLeft/Joern
---
# Joern
## 매 한 줄
> **"매 Code Property Graph (CPG)를 query 하는 SAST 플랫폼 — 매 AST + CFG + DDG 통합 graph"**. 매 Yamaguchi 박사 논문에서 출발 — 매 ShiftLeft가 사실상의 사업화 — 매 2026 기준 매 C/C++/Java/Python/JS/Go 매 multi-language 매 OSS SAST 의 reference.
## 매 핵심
### 매 CPG 란
- AST (syntax) + CFG (control flow) + DDG (data dependence) 통합 단일 graph.
- Node: function, identifier, literal, call, parameter, …
- Edge: AST_PARENT, CFG, REACHING_DEF, CALL, …
### 매 query language
- 매 CPGQL — Scala-based DSL.
- 매 example: `cpg.call("strcpy").argument(2).reachableBy(cpg.parameter).p`
### 매 응용
1. 매 vulnerability hunting — taint trace src→sink.
2. 매 code review automation — pattern grep 보다 더 deep.
3. 매 SBOM/SCA 보완 — first-party code의 weakness.
## 💻 패턴
### 매 install + import
```bash
brew install joern # 매 macOS
joern
joern> importCode(inputPath="/path/to/repo", projectName="myapp")
joern> open("myapp")
```
### 매 dangerous call 매 query
```scala
cpg.call.name("strcpy|gets|sprintf").l
// 매 location 매 method 매 list
cpg.call.name("strcpy").map(c => (c.method.name, c.lineNumber)).l
```
### 매 taint flow (SQL injection)
```scala
def src = cpg.call.name("getParameter")
def sink = cpg.call.name("executeQuery")
sink.reachableByFlows(src).p
```
### 매 custom rule (XSS)
```scala
def userInput = cpg.call.name(".*request.*get.*Param.*")
def htmlSink = cpg.call.name(".*innerHTML.*|.*document\\.write.*")
htmlSink.reachableByFlows(userInput).p
```
### 매 method-level metric
```scala
cpg.method.where(_.numberOfLines.gt(100)).name.l
cpg.method.controlStructure.size // 매 cyclomatic 근사
```
### 매 export
```scala
cpg.runScript("exportCpg.sc", Map("outFile" -> "/tmp/cpg.bin.zip"))
// 매 GraphML/dot 도 가능
```
### 매 CI integration
```yaml
- name: Joern scan
run: |
joern-parse src/
joern-scan --dump cpg.bin.zip > findings.json
```
### 매 ocular (commercial fork)
```scala
// 매 ShiftLeft Ocular = Joern + secrets + IaC
// 매 enterprise 매 secrets/license/SBOM 통합
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 quick grep | semgrep/CodeQL |
| 매 deep taint multi-lang OSS | Joern |
| 매 enterprise + secret + SBOM | ShiftLeft / Snyk Code |
| 매 binary | Ghidra + plugin |
**기본값**: OSS multi-language SAST — Joern.
## 🔗 Graph
- 부모: [[SAST]] · [[Code_Property_Graph]]
- 변형: [[CodeQL]] · [[Semgrep]]
- 응용: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]]
- Adjacent: [[보안 및 시스템 신뢰성 표준|DAST]] · [[SCA_Fundamentals|SCA]]
## 🤖 LLM 활용
**언제**: 매 cross-function taint trace 필요 — string-grep 매 부족할 때.
**언제 X**: 매 single-line pattern — semgrep 매 빠르고 충분.
## ❌ 안티패턴
- **CPG 매 too large 매 RAM**: 매 module 단위 분리 import.
- **regex 매 method name 매 over-broad**: 매 false positive 폭발.
- **flow 매 결과 매 그대로 trust**: 매 sanitizer 매 modeling 안 됐을 수도.
## 🧪 검증 / 중복
- Verified (Joern 4.x, joern.io 2026).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — CPG/CPGQL 기반 SAST 패턴 정리 |
@@ -0,0 +1,216 @@
---
id: wiki-2026-0508-logging-and-error-handling
title: Logging and Error Handling
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Structured Logging, Observability Logging]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [observability, logging, error-handling]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript/Go
framework: OpenTelemetry/pino/zap
---
# Logging and Error Handling
## 매 한 줄
> **"매 logs 는 events, errors 는 values"**. 매 modern stack (2026) 의 structured JSON logging + correlation IDs + OpenTelemetry trace propagation 의 default. Errors 는 typed values (Result/Either) 의 throw 보다 explicit propagation 의 prefer.
## 매 핵심
### 매 Logging levels
- **TRACE**: extreme detail, dev only.
- **DEBUG**: variables, branch decisions.
- **INFO**: lifecycle events (request start/end, job success).
- **WARN**: degraded but recoverable (retry, fallback).
- **ERROR**: failed operation, attention needed.
- **FATAL**: process-terminating.
### 매 Structured logging
- 매 string concatenation 의 X — JSON object emit.
- 매 stable field names (`user_id`, `request_id`, `trace_id`).
- 매 PII redaction at serialization (never log passwords, tokens).
- 매 sampling (1% INFO in hot path) for cost control.
### 매 Error handling philosophies
- **Exceptions**: Java, Python, Ruby. Easy default, but invisible control flow.
- **Return values**: Go (`err`), Rust (`Result<T, E>`). Explicit, ugly.
- **Effect systems**: Effect-TS, ZIO. Typed effects, composable.
- **Panics**: Rust/Go for unrecoverable bugs.
### 매 응용
1. SRE postmortems (logs as evidence).
2. Distributed tracing (correlation across services).
3. Audit trails (compliance — SOC 2, GDPR).
4. Anomaly detection feeds.
5. Customer support debugging.
## 💻 패턴
### Structured logging (TypeScript with pino)
```typescript
import pino from 'pino';
const logger = pino({
level: process.env.LOG_LEVEL ?? 'info',
redact: ['*.password', '*.token', 'req.headers.authorization'],
formatters: {
level: (label) => ({ level: label }),
},
});
logger.info(
{ user_id: 123, request_id: req.id, latency_ms: 45 },
'request handled',
);
```
### Trace correlation (OpenTelemetry)
```typescript
import { trace, context } from '@opentelemetry/api';
function handler(req, res) {
const span = trace.getActiveSpan();
const traceId = span?.spanContext().traceId;
logger.info({ trace_id: traceId, request_id: req.id }, 'received');
// child operation auto-inherits trace_id
context.with(trace.setSpan(context.active(), span!), () => {
processRequest(req);
});
}
```
### Result type (Rust-style in TypeScript)
```typescript
type Ok<T> = { ok: true; value: T };
type Err<E> = { ok: false; error: E };
type Result<T, E> = Ok<T> | Err<E>;
async function fetchUser(id: string): Promise<Result<User, 'NotFound' | 'NetworkError'>> {
try {
const r = await fetch(`/users/${id}`);
if (r.status === 404) return { ok: false, error: 'NotFound' };
if (!r.ok) return { ok: false, error: 'NetworkError' };
return { ok: true, value: await r.json() };
} catch {
return { ok: false, error: 'NetworkError' };
}
}
// Caller forced to handle both branches
const r = await fetchUser('42');
if (!r.ok) {
if (r.error === 'NotFound') return res.status(404).end();
return res.status(503).end();
}
```
### Error boundaries (React/preact)
```tsx
class ErrorBoundary extends Component {
componentDidCatch(error: Error, info: ErrorInfo) {
logger.error({ error: error.message, stack: error.stack, ...info }, 'render error');
Sentry.captureException(error, { extra: info });
}
render() {
if (this.state.hasError) return <Fallback />;
return this.props.children;
}
}
```
### Go error wrapping
```go
import "fmt"
func fetchOrder(id string) (*Order, error) {
raw, err := db.Query(id)
if err != nil {
return nil, fmt.Errorf("fetchOrder %s: %w", id, err)
}
return parseOrder(raw)
}
// Caller can unwrap
if errors.Is(err, sql.ErrNoRows) { /* ... */ }
```
### Error budgets and alerting
```typescript
// Log every error, but only alert on rate
const errorRate = new Counter({
name: 'http_errors_total',
labelNames: ['route', 'code'],
});
app.use((err, req, res, next) => {
errorRate.inc({ route: req.route?.path, code: err.code });
logger.error({ err, req_id: req.id }, 'unhandled');
res.status(500).json({ error: 'internal' });
});
// Prometheus rule: rate(http_errors_total[5m]) > 0.01 → page
```
### Sampling for high-volume logs
```typescript
const sampledLogger = logger.child({}, {
level: 'info',
// 1% of info logs, 100% of warn+
hooks: {
logMethod(args, method, level) {
if (level === 30 && Math.random() > 0.01) return;
method.apply(this, args);
},
},
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Web service errors | Result types or wrapped exceptions |
| Critical assertion failure | Panic/process exit |
| Expected user input failure | Domain error type, never exception |
| Cross-service correlation | OpenTelemetry trace_id |
| PII in logs | Redact at serializer + DLP scan |
| Log retention | Hot 7d / warm 30d / cold 1y |
**기본값**: structured JSON + OTel trace IDs + Result types for domain logic + Sentry for unhandled.
## 🔗 Graph
- 부모: [[Observability]] · [[SRE]]
- 변형: [[Distributed Tracing]] · [[Type-safe Error Handling Exhaustiveness Checking]]
- 응용: [[Engineering Metrics (DORA)]] · [[Anomaly-Detection]]
- Adjacent: [[Flame_Graphs]] · [[경고 피로 (Alert Fatigue)]]
## 🤖 LLM 활용
**언제**: generate structured log statements with consistent fields, refactor exception-throws to Result types.
**언제 X**: never ask LLM to invent error taxonomy from scratch — derive from product domain.
## ❌ 안티패턴
- **`console.log` in prod**: no levels, no structure.
- **Catch and swallow**: `try { } catch { }` — invisible failure.
- **Generic exceptions**: `throw new Error("oops")` — caller can't discriminate.
- **PII in logs**: passwords, full credit card, JWT bodies.
- **Log spam**: per-iteration debug logs in tight loops.
- **Stringly-typed errors**: `if (err.message === "not found")` — fragile.
## 🧪 검증 / 중복
- Verified (OpenTelemetry spec, Google SRE book ch.16, Effect-TS docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — structured logging + Result patterns |
@@ -0,0 +1,134 @@
---
id: wiki-2026-0508-major-gc
title: Major GC
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [full-gc, old-generation-gc, mark-sweep-compact]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [gc, v8, memory, performance, jvm]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: JavaScript
framework: V8
---
# Major GC
## 매 한 줄
> **"매 Old generation 매 전체를 매 sweep 하는 매 비싼 GC cycle — 매 mark-sweep-compact 의 합성"**. 매 minor GC (Scavenge)와 대비되는 V8 의 second-tier collector — 매 long-lived object 의 final destination — 매 stop-the-world pause 의 가장 큰 원인.
## 매 핵심
### 매 단계
1. **Mark**: 매 root → reachable object tree-walk, mark bit set.
2. **Sweep**: 매 unmarked region 의 free list 추가.
3. **Compact**: 매 fragmentation 의 reduce 매 live object 매 좌측 이동.
### 매 trigger
- 매 old-space 매 limit 도달.
- 매 minor GC 매 promotion 매 spike.
- 매 manual `--expose-gc` + `gc()` 호출.
### 매 응용
1. 매 long-running Node.js server 매 latency 의 source.
2. 매 GC tuning 의 핵심 metric.
## 💻 패턴
### 매 GC log enable
```bash
node --trace-gc app.js
# 매 sample
# [12345:0x...] [Mark-Compact 250.4MB->180.2MB (300.0MB) 45.3 ms]
```
### 매 PerformanceObserver
```javascript
const obs = new PerformanceObserver((list) => {
for (const entry of list.getEntries()) {
if (entry.detail.kind === 4) // 매 major GC
console.log('Major GC:', entry.duration, 'ms');
}
});
obs.observe({ entryTypes: ['gc'] });
```
### 매 heap snapshot
```javascript
const v8 = require('v8');
v8.writeHeapSnapshot('/tmp/snap.heapsnapshot');
// 매 Chrome DevTools → Memory tab 매 load
```
### 매 incremental marking
```bash
node --trace-incremental-marking app.js
# 매 V8 매 mark phase 의 매 frame budget chunk 로 분할
```
### 매 max-old-space-size
```bash
node --max-old-space-size=4096 app.js # 매 4GB
# 매 default 1.4GB on 64-bit
```
### 매 weak ref pattern
```javascript
const cache = new Map();
const ref = new WeakRef(obj);
// 매 GC 매 obj 의 collect 매 cache 의 자동 cleanup
const finalizer = new FinalizationRegistry((key) => cache.delete(key));
```
### 매 promotion threshold tune
```bash
node --min-semi-space-size=64 --max-semi-space-size=128 app.js
// 매 young gen 의 크기 의 키워서 promotion 의 줄임
```
### 매 chrome devtools profile
```javascript
// 매 Performance tab → Record → 매 GC marker 의 yellow bar
// 매 매 marker 매 click → reason: "allocation failure" / "external memory"
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 frequent major GC | 매 heap profile + leak hunt |
| 매 GC pause >100ms | --max-old-space-size 의 increase |
| 매 promotion 폭발 | --max-semi-space-size 의 increase |
| 매 long-lived cache | WeakRef + FinalizationRegistry |
**기본값**: 매 trace-gc 로그로 baseline → 매 profile 후 매 tune.
## 🔗 Graph
- 부모: [[V8 가비지 컬렉션(Garbage Collection)]] · [[가비지 컬렉터(Garbage Collector)]]
- 변형: [[Mark-Sweep-Compact(메이저 GC)]] · [[오리노코(Orinoco GC)]]
- 응용: [[Stop-the-world]] · [[Memory Management]]
- Adjacent: [[Scavenge]] · [[New Space(Young Generation)]]
## 🤖 LLM 활용
**언제**: 매 Node.js latency spike 매 trace-gc 결과 의 해석.
**언제 X**: 매 minor GC 의 frequent — Scavenge 분석.
## ❌ 안티패턴
- **manual gc() 의 spam**: 매 incremental marking 의 방해.
- **--expose-gc 의 prod**: 매 attacker 의 DoS vector.
- **heap-size 의 무한 증가**: 매 swap 의 trash 매 latency 폭발.
## 🧪 검증 / 중복
- Verified (V8 12.x, Node.js 22+, 2026).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Major GC mark-sweep-compact 단계 + tuning 정리 |
@@ -0,0 +1,159 @@
---
id: wiki-2026-0508-malware-analysis
title: Malware Analysis
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [malware-rev, threat-analysis, reverse-engineering-malware]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, malware, reverse-engineering, threat-intel, forensics]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Python/C
framework: Ghidra/IDA/YARA
---
# Malware Analysis
## 매 한 줄
> **"매 악성 binary의 매 behavior + capability + IOC 의 추출"**. 매 static (disassembly, string, import) ↔ dynamic (sandbox, instrumentation) ↔ hybrid 의 3-tier — 매 2026 매 LLM-assisted reversing 의 confluence — 매 incident response의 bottleneck.
## 매 핵심
### 매 3 가지 분석 mode
1. **Static**: 매 비실행 — strings, PE header, import table, YARA, signature.
2. **Dynamic**: 매 sandbox 실행 — API calls, network, file mod, registry.
3. **Hybrid**: 매 static 으로 매 hint 추출 → dynamic 으로 매 path 매 trigger.
### 매 IOC types
- **File**: SHA256, imphash.
- **Network**: domain, IP, URL, JA3 fingerprint.
- **Host**: registry key, mutex, persistence path.
- **Behavior**: MITRE ATT&CK technique.
### 매 응용
1. 매 SOC incident triage.
2. 매 threat intel feed 의 enrichment.
3. 매 detection rule (YARA, Sigma) 의 author.
## 💻 패턴
### 매 file triage
```bash
file suspicious.bin
sha256sum suspicious.bin
strings -n 8 suspicious.bin | head -50
exiftool suspicious.bin
```
### 매 PE inspect
```bash
pefile-info suspicious.exe # python pefile
# 매 imphash 매 family clustering
python -c "import pefile; print(pefile.PE('m.exe').get_imphash())"
```
### 매 YARA rule
```yara
rule SuspiciousLoader {
meta:
author = "analyst"
date = "2026-05-10"
strings:
$s1 = "VirtualAlloc" ascii
$s2 = "WriteProcessMemory" ascii
$s3 = { 48 8B ?? ?? E8 ?? ?? ?? ?? 48 85 C0 74 }
condition:
uint16(0) == 0x5A4D and 2 of ($s*)
}
// scan: yara -r rules.yar samples/
```
### 매 Ghidra script (headless)
```bash
analyzeHeadless /tmp/proj proj1 -import sample.exe \
-postScript ExtractStrings.java -deleteProject
```
### 매 sandbox (CAPE / Cuckoo)
```bash
cape submit suspicious.exe --timeout 120 --options "procmemdump=yes"
# 매 result: API trace, network pcap, dropped files
```
### 매 IDA Python
```python
import idautils, idaapi
for func in idautils.Functions():
name = idaapi.get_name(func)
if 'crypt' in name.lower():
print(hex(func), name)
```
### 매 unpacking heuristic
```python
# 매 entropy >7.0 매 packed 의 강한 signal
import math, collections
def entropy(data):
cnt = collections.Counter(data)
total = len(data)
return -sum((c/total) * math.log2(c/total) for c in cnt.values())
```
### 매 LLM-assisted (Claude Opus 4.7)
```python
# 매 disassembly chunk 의 의미 의 explain
prompt = f"Analyze this x86_64 function and identify behavior:\n{disasm}"
# 매 Ghidra plugin → MCP → Claude API 매 round-trip
```
### 매 MITRE ATT&CK mapping
```yaml
behaviors:
- tactic: Defense Evasion
technique: T1055 # Process Injection
evidence: VirtualAllocEx + WriteProcessMemory + CreateRemoteThread
- tactic: Persistence
technique: T1547.001 # Registry Run Keys
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 known-bad triage | hash/imphash lookup |
| 매 unknown sample | static + sandbox 병행 |
| 매 packed | unpack + dump 후 static |
| 매 APT custom | 매 hybrid + LLM-assisted reversing |
**기본값**: 매 imphash + YARA 의 quick pass → 매 sandbox detonate → 매 manual reverse.
## 🔗 Graph
- 부모: [[Security]]
- 변형: [[Static Analysis]]
- 응용: [[Anomaly-Detection]]
- Adjacent: [[SAST]] · [[Code Obfuscation]]
## 🤖 LLM 활용
**언제**: 매 disassembly 의 의미 해석, 매 obfuscated string 의 deobfuscation.
**언제 X**: 매 IOC extraction 의 numeric — 매 deterministic tooling 사용.
## ❌ 안티패턴
- **production 매 sandbox**: 매 lateral movement 의 위험.
- **YARA rule 매 too generic**: 매 false positive 폭발.
- **strings only**: 매 packed 매 useless.
- **LLM 답 의 blind trust**: 매 hallucinated API behavior 위험.
## 🧪 검증 / 중복
- Verified (Ghidra 11.x, YARA 4.5, MITRE ATT&CK v15, 2026).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — static/dynamic/hybrid 분석 + LLM-assisted 정리 |
@@ -0,0 +1,173 @@
---
id: wiki-2026-0508-media-literacy
title: Media Literacy
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Information Literacy, Source Evaluation, Digital Literacy]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [media-literacy, information, verification, deepfake, security]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: c2pa
---
# Media Literacy
## 매 한 줄
> **"매 source 의 verify, claim 의 cross-check, framing 의 detect — 매 information 의 evaluate skill"**. 매 1990s NAMLE 시작, 매 2026 LLM-generated content + deepfake + C2PA provenance + AI watermark 의 era 에 매 default skill.
## 매 핵심
### 매 Core skills (5)
- **Access**: 매 reliable source 의 find.
- **Analyze**: bias, framing, omission 의 detect.
- **Evaluate**: credibility, evidence quality.
- **Create**: ethical content production.
- **Act**: misinformation 의 counter.
### 매 SIFT method (Caulfield)
- **Stop**: 매 click 전 pause.
- **Investigate**: source 의 background.
- **Find**: better/original coverage.
- **Trace**: claim 의 original context.
### 매 응용
1. Deepfake detection: C2PA provenance + ML classifier.
2. LLM output: hallucination 의 detect.
3. News pipeline: source ranking.
## 💻 패턴
### C2PA manifest verification
```python
# 매 image 의 provenance 의 verify
from c2pa import Reader
reader = Reader.from_file('photo.jpg')
manifest = reader.json()
print(f"Producer: {manifest['active_manifest']['claim_generator']}")
print(f"AI generated: {manifest.get('ai_generated', False)}")
print(f"Signature valid: {reader.validation_status()}")
```
### AI watermark detection (SynthID-like)
```python
# 매 LLM output 매 watermark 의 detect
import torch
def detect_watermark(text: str, key: bytes, threshold=0.6) -> bool:
tokens = tokenize(text)
# green-list ratio (Kirchenbauer 2023)
green = sum(1 for t in tokens if hash_token(t, key) % 2 == 0)
z = (green - 0.5*len(tokens)) / (0.25*len(tokens))**0.5
return z > threshold * 5 # 매 strict threshold
```
### Reverse image search (TinEye API)
```python
import httpx
def reverse_search(image_path: str, api_key: str):
with open(image_path, 'rb') as f:
r = httpx.post('https://api.tineye.com/rest/search/',
files={'image_upload': f},
auth=(api_key, ''))
matches = r.json()['results']['matches']
return [(m['image_url'], m['domain'], m['crawl_date']) for m in matches[:5]]
```
### Source credibility score
```python
TRUSTED_DOMAINS = {'reuters.com': 0.95, 'apnews.com': 0.93, 'nature.com': 0.97}
SUSPICIOUS = {'.tk', '.click'}
def score_source(url: str) -> float:
from urllib.parse import urlparse
domain = urlparse(url).netloc.lower().lstrip('www.')
if domain in TRUSTED_DOMAINS: return TRUSTED_DOMAINS[domain]
if any(domain.endswith(s) for s in SUSPICIOUS): return 0.1
return 0.5 # unknown
```
### Deepfake classifier (FaceForensics++)
```python
import torch
from transformers import AutoModelForImageClassification, AutoImageProcessor
model = AutoModelForImageClassification.from_pretrained(
'prithivMLmods/Deep-Fake-Detector-v2-Model')
proc = AutoImageProcessor.from_pretrained('prithivMLmods/Deep-Fake-Detector-v2-Model')
def is_deepfake(img) -> tuple[bool, float]:
inputs = proc(images=img, return_tensors='pt')
with torch.no_grad():
logits = model(**inputs).logits
probs = logits.softmax(-1)[0]
fake_prob = probs[1].item()
return fake_prob > 0.5, fake_prob
```
### Cross-reference fact-check
```python
import asyncio, httpx
async def fact_check(claim: str):
async with httpx.AsyncClient() as c:
r = await c.get('https://factchecktools.googleapis.com/v1alpha1/claims:search',
params={'query': claim, 'key': 'KEY'})
results = r.json().get('claims', [])
return [(x['text'], x['claimReview'][0]['textualRating']) for x in results]
```
### Browser ext: provenance badge
```ts
// content.ts
async function annotateImages() {
for (const img of document.querySelectorAll('img')) {
const r = await fetch(`/api/c2pa-check?url=${encodeURIComponent(img.src)}`);
const { aiGenerated, verified } = await r.json();
if (aiGenerated) img.style.outline = '3px solid orange';
if (!verified) img.title = '매 provenance unverified';
}
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| News article | SIFT method |
| Image authenticity | C2PA + reverse search + deepfake classifier |
| LLM output | watermark detect + cross-reference |
| Suspicious domain | credibility score < 0.3 → reject |
**기본값**: SIFT + tooling-augmented (C2PA, fact-check API).
## 🔗 Graph
- 부모: [[Information Literacy]]
- 변형: [[Source Evaluation]]
- 응용: [[Deepfake-Detection]]
- Adjacent: [[Conversational-Maxims]] · [[Procedural-Rhetoric]]
## 🤖 LLM 활용
**언제**: claim cross-reference, framing analysis, summary 의 bias detect.
**언제 X**: 매 LLM 자체 매 hallucinate — 매 외부 source 와 cross-check 필수.
## ❌ 안티패턴
- **Headline reading**: 매 click 만 하고 article body 매 읽지 X.
- **Single source**: corroboration 매 X.
- **Bothsidesism**: 매 lopsided evidence 의 false equivalence.
- **No provenance check**: image 매 viral spread 후 reverse search X.
## 🧪 검증 / 중복
- Verified (NAMLE Core Principles, C2PA spec 2.0, SIFT method by Mike Caulfield).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — SIFT + C2PA + deepfake tooling |
@@ -0,0 +1,158 @@
---
id: wiki-2026-0508-memory-management
title: Memory Management
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [memory-mgmt, heap-management]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [memory, gc, performance, runtime, systems]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C/JS/Rust
framework: V8/JVM/glibc
---
# Memory Management
## 매 한 줄
> **"매 program 매 lifetime 동안 의 allocation/deallocation 의 전략"**. 매 manual (C/C++) ↔ ARC (Swift/ObjC) ↔ tracing GC (V8/JVM) ↔ ownership (Rust) — 매 spectrum 의 각 trade-off — 매 2026 의 mainstream 4 가지 paradigm 의 공존.
## 매 핵심
### 매 4 가지 paradigm
1. **Manual**: malloc/free, new/delete — 매 control 최대, 매 leak 위험.
2. **Reference counting**: ARC, shared_ptr — 매 deterministic, 매 cycle 문제.
3. **Tracing GC**: V8, JVM, .NET — 매 productivity, 매 pause.
4. **Ownership**: Rust borrow checker — 매 zero-runtime overhead, 매 learning curve.
### 매 핵심 metric
- **RSS** (resident set size): 매 OS 시점.
- **Heap used**: 매 runtime 시점.
- **External**: 매 native buffer (Node `Buffer`).
- **Fragmentation**: 매 allocate 가능하지만 매 contiguous block 부재.
### 매 응용
1. 매 long-running server 의 stability.
2. 매 game engine 의 frame budget.
3. 매 embedded 의 RAM 의 limit.
## 💻 패턴
### 매 manual (C)
```c
char *buf = malloc(1024);
if (!buf) { perror("malloc"); exit(1); }
// ... use ...
free(buf);
buf = NULL; // 매 dangling 의 방지
```
### 매 RAII (C++)
```cpp
{
std::unique_ptr<MyObj> p = std::make_unique<MyObj>();
// 매 scope exit 매 자동 delete
}
std::shared_ptr<MyObj> sp = std::make_shared<MyObj>();
// 매 ref-count 0 매 free
```
### 매 ownership (Rust)
```rust
fn take(s: String) { /* 매 drop on end */ }
let owned = String::from("hi");
take(owned);
// println!("{}", owned); // 매 compile error: moved
```
### 매 tracing GC (JS)
```javascript
let cache = new Map();
cache.set('a', { big: new Array(1e6) });
cache = null; // 매 GC 의 next cycle 의 reclaim
// 매 WeakMap 매 key 의 GC 자동 cleanup
const wm = new WeakMap();
```
### 매 Node memory inspect
```javascript
const v8 = require('v8');
console.log(v8.getHeapStatistics());
// { total_heap_size: ..., used_heap_size: ..., heap_size_limit: ... }
process.memoryUsage();
// { rss, heapTotal, heapUsed, external, arrayBuffers }
```
### 매 leak detection (Node)
```bash
node --inspect app.js
# Chrome DevTools → Memory → Take snapshot → 매 sample 3 개 → comparison view
node --heapsnapshot-signal=SIGUSR2 app.js
kill -USR2 $(pgrep node)
```
### 매 pool allocator
```cpp
class Pool {
std::vector<MyObj*> free_;
public:
MyObj* acquire() {
if (free_.empty()) return new MyObj();
auto* p = free_.back(); free_.pop_back(); return p;
}
void release(MyObj* p) { free_.push_back(p); }
};
// 매 hot path 매 alloc 의 amortize
```
### 매 arena (Rust bumpalo)
```rust
use bumpalo::Bump;
let arena = Bump::new();
let s = arena.alloc(String::from("hi"));
let v = arena.alloc(vec![1, 2, 3]);
// 매 arena drop 매 모두 free — 매 deallocation O(1)
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 systems / kernel | manual + sanitizer |
| 매 high-perf game | RAII + pool |
| 매 server productive | tracing GC + tune |
| 매 safety + perf | Rust ownership |
| 매 short-lived bulk | arena |
**기본값**: 매 language idiom 따름 — 매 C++ RAII, 매 JS GC, 매 Rust ownership.
## 🔗 Graph
- 부모: [[Performance]]
- 변형: [[Garbage Collection]] · [[ARC]] · [[Ownership]]
- 응용: [[V8 Engine Heap Management]] · [[Major GC]]
- Adjacent: [[가비지 컬렉터(Garbage Collector)]] · [[힙 메모리(Heap Memory)]]
## 🤖 LLM 활용
**언제**: 매 memory leak / OOM 의 hunt 매 paradigm 의 선택.
**언제 X**: 매 high-level business logic 의 memory 의 의식 안 해도 됨.
## ❌ 안티패턴
- **manual + GC mix 매 over-confidence**: 매 native buffer leak.
- **shared_ptr cycle**: 매 weak_ptr 의 break.
- **arena 매 long-lived**: 매 effective leak.
- **Rust 매 unsafe 의 무분별**: 매 borrow checker 의 우회.
## 🧪 검증 / 중복
- Verified (V8/JVM/Rust/glibc 2026 documentation).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — 4가지 메모리 관리 paradigm 비교 + pattern 정리 |
@@ -0,0 +1,159 @@
---
id: wiki-2026-0508-network-coordinate-systems
title: Network Coordinate Systems
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [NCS, Vivaldi, network coordinates, latency embedding]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [networking, distributed-systems, latency, p2p]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Go/Rust
framework: HashiCorp Serf, libp2p
---
# Network Coordinate Systems
## 매 한 줄
> **"매 host 를 매 low-dim Euclidean space 의 점으로 embed 하여 매 RTT 를 매 distance 로 predict"**. 매 2004 MIT Vivaldi paper 가 매 seminal — 매 N×N RTT measurement 의 O(N²) 폭발 의 회피. 매 2026 service mesh / CDN edge selection / P2P overlay 의 매 building block.
## 매 핵심
### 매 motivation
- 매 N node 매 mesh 의 매 N² RTT probe = 매 1000 node = 1M probe.
- 매 NCS: 매 O(N) coordinate update 로 매 any pair 의 RTT predict.
- 매 update 매 lazy — 매 gossip / piggyback 매 existing message.
### 매 Vivaldi (대표 algorithm)
- 매 spring relaxation: 매 measured RTT 와 매 predicted distance 의 error 가 매 force.
- 매 height vector h: 매 access link latency 의 capture (Euclidean 의 X 인 매 last-mile).
- 매 dim 5-7 차 + height 1 차: 매 internet topology 의 충분한 fit.
### 매 응용
1. CDN edge selection (Cloudflare Argo).
2. Service mesh locality routing (HashiCorp Consul).
3. P2P overlay neighbor selection (libp2p).
4. Cluster placement (Kubernetes topology-aware).
## 💻 패턴
### 1. Vivaldi update step (Go-style)
```go
type Coord struct {
Vec []float64 // 8-dim
Height float64
Error float64 // local confidence
}
const Cc, Ce = 0.25, 0.25
func (a *Coord) Update(b *Coord, rttSeconds float64) {
predicted := dist(a, b)
relErr := math.Abs(predicted-rttSeconds) / rttSeconds
w := a.Error / (a.Error + b.Error)
a.Error = relErr*Ce*w + a.Error*(1-Ce*w)
delta := Cc * w
direction := unitVec(sub(a.Vec, b.Vec))
force := (rttSeconds - predicted) * delta
for i := range a.Vec {
a.Vec[i] += direction[i] * force
}
a.Height = math.Max(0.001, a.Height+(rttSeconds-predicted)*delta*0.5)
}
```
### 2. Distance prediction
```go
func dist(a, b *Coord) float64 {
sumSq := 0.0
for i := range a.Vec {
d := a.Vec[i] - b.Vec[i]
sumSq += d * d
}
return math.Sqrt(sumSq) + a.Height + b.Height
}
```
### 3. Gossip-based update (Serf-style)
```go
// On every gossip message exchange:
func (s *Serf) onPing(peer Node, rtt time.Duration) {
s.coord.Update(peer.Coord, rtt.Seconds())
s.broadcast(s.coord)
}
```
### 4. Edge selection (CDN)
```go
func nearestEdge(client *Coord, edges []Edge) Edge {
best := edges[0]
bestDist := dist(client, best.Coord)
for _, e := range edges[1:] {
if d := dist(client, e.Coord); d < bestDist {
best, bestDist = e, d
}
}
return best
}
```
### 5. Confidence-weighted query
```go
func predictRTT(a, b *Coord) (float64, float64) {
rtt := dist(a, b)
confidence := 1.0 - math.Min(a.Error+b.Error, 1.0)
return rtt, confidence
}
```
### 6. Pharos (hierarchical NCS)
```go
// Two-tier: global coord + cluster-local coord
type PharosCoord struct {
Global Coord // inter-cluster
Local Coord // intra-cluster
Cluster string
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| < 50 nodes | Direct N² probe — NCS overkill |
| 50-10k nodes (mesh) | Vivaldi (HashiCorp Serf 매 default) |
| > 10k geo-distributed | Pharos (hierarchical) or HTRAE |
| Adversarial / Byzantine | Newton (outlier-resistant) |
| Edge selection only | Anycast + GeoIP 매 simpler |
**기본값**: Vivaldi 8-dim + height (Serf-compatible).
## 🔗 Graph
- 부모: [[Distributed Systems]]
- 응용: [[Service Mesh]]
## 🤖 LLM 활용
**언제**: 매 100+ node mesh 매 latency-aware routing/placement 가 필요. 매 RTT measurement 의 O(N²) 폭발 회피.
**언제 X**: 매 small cluster (< 50). 매 BGP anycast 매 충분한 단순 edge selection. 매 Byzantine adversary present.
## ❌ 안티패턴
- **Triangle inequality 의 violation 무시**: 매 internet 의 매 routing asymmetry 매 strict triangle 위반 — 매 height vector 매 partial 해결.
- **High-dim 매 사용**: 매 16+ dim 매 overfitting + 매 update cost 증가. 매 8 dim 매 sweet spot.
- **Cold start 매 0 vector**: 매 random init 매 collapse 회피.
- **Confidence 무시**: 매 fresh node 의 coord 매 unreliable — 매 Error field 매 weight 사용.
## 🧪 검증 / 중복
- Verified (Vivaldi: Dabek et al., SIGCOMM 2004; HashiCorp Serf source 2026-05).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Vivaldi spring-relaxation + Serf 의 production usage |
@@ -0,0 +1,168 @@
---
id: wiki-2026-0508-new-space-young-generation
title: New Space (Young Generation)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Young Generation, Eden + Survivor, Scavenger, Minor GC, Nursery]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [gc, v8, jvm, generational-gc, memory-management]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C++
framework: V8, HotSpot JVM, .NET
---
# New Space (Young Generation)
## 매 한 줄
> **"매 generational GC 의 short-lived object region"**. 매 1984 Lieberman & Hewitt 의 매 generational hypothesis ("most objects die young") 매 base. 매 V8 의 New Space (Scavenger), 매 JVM 의 Young Gen (Eden + 2 Survivor), 매 .NET 의 Gen 0/1 — 매 모두 매 동일한 idea: 매 young object 매 cheap copy + 매 old object 매 promote.
## 매 핵심
### 매 generational hypothesis
- 매 90%+ object 매 매 first GC cycle 의 die.
- 매 survivor 매 long-lived 가능 매 high.
- 매 separate region + 매 separate algorithm 매 efficient.
### 매 V8 New Space 구조
- 매 to-space + from-space (semispace).
- 매 Cheney's Scavenge (Cheney 1970) — 매 BFS copy.
- 매 size 매 1-8MB per isolate (V8 12+ adaptive).
- 매 minor GC: 매 < 1ms typical.
- 매 promotion: 매 2회 survive 시 Old Space 로 이동.
### 매 JVM Young Gen 구조
- 매 Eden (allocation site) + Survivor 0 + Survivor 1.
- 매 Eden full → 매 minor GC → 매 live → S0 (or S1).
- 매 매 매 Tenuring threshold (default 15) 도달 → Old Gen.
### 매 응용
1. JS engine (V8 / SpiderMonkey / JavaScriptCore).
2. JVM (HotSpot G1, ZGC, Parallel).
3. .NET CLR.
4. Dart VM.
5. Lua의 incremental (slightly different).
## 💻 패턴
### 1. V8 heap snapshot 측정
```ts
import v8 from 'node:v8';
const stats = v8.getHeapSpaceStatistics();
const newSpace = stats.find(s => s.space_name === 'new_space');
console.log({
size: newSpace.space_size,
used: newSpace.space_used_size,
available: newSpace.space_available_size,
});
```
### 2. V8 GC trace flag
```bash
node --trace-gc app.js
# [12345:0x1234] 234 ms: Scavenge 4.5 (5.3) -> 0.8 (5.3) MB, 1.2 ms
node --trace-gc-verbose --max-semi-space-size=64 app.js
```
### 3. Allocation site 의 promotion 회피
```ts
// 매 hot loop 의 ephemeral 의 ㅇ
function processStream(items: Item[]) {
for (const item of items) {
const tmp = { x: item.x * 2, y: item.y * 2 }; // 매 New Space alloc
emit(tmp); // 매 die immediately — minor GC 의 reclaim
}
}
// 매 X — 매 long-lived array 의 promotion
const cache: Record<string, Result> = {};
function bad(item: Item) {
cache[item.id] = compute(item); // 매 Old Space promotion
}
```
### 4. JVM Young Gen tuning
```bash
java -Xms2g -Xmx8g \
-XX:NewRatio=2 \
-XX:SurvivorRatio=8 \
-XX:MaxTenuringThreshold=10 \
-XX:+UseG1GC \
-Xlog:gc*:file=gc.log \
App
```
### 5. Pretenuring (object 의 사전 Old 배치)
```cpp
// V8 internal: AllocationSite 가 매 history 추적 → 매 large/long-lived 매 immediate Old.
// 매 user-facing API X — 매 V8 의 implicit.
// 매 application 의 hint: 매 reuse object pool.
```
### 6. Object pool (allocation pressure 회피)
```ts
class Vec3Pool {
private pool: Vec3[] = [];
acquire(): Vec3 {
return this.pool.pop() ?? new Vec3();
}
release(v: Vec3) {
v.set(0, 0, 0);
if (this.pool.length < 1000) this.pool.push(v);
}
}
// 매 매 frame 의 allocation 의 X → minor GC 매 silent
```
### 7. .NET Gen 0 stats
```csharp
GC.Collect(0); // 매 Gen 0 (Young) 매 only
Console.WriteLine($"Gen0: {GC.CollectionCount(0)}");
Console.WriteLine($"Gen1: {GC.CollectionCount(1)}");
Console.WriteLine($"Gen2: {GC.CollectionCount(2)}");
```
## 매 결정 기준
| 상황 | New Space tuning |
|---|---|
| Allocation-heavy (web server) | 매 large New Space (V8 64-256MB) — 매 Scavenge frequency 줄임 |
| Long-lived state (cache) | 매 small New Space — 매 promote fast |
| Latency-critical (game) | 매 object pool + 매 zero-alloc hot path |
| Memory-tight (mobile) | 매 default + GC tuning 의 X |
| Long debugging session | --trace-gc + heap snapshot |
**기본값**: 매 V8 default New Space + 매 hot path 의 object pool 사용.
## 🔗 Graph
- 부모: [[Garbage Collection]]
- 변형: [[Old_Space|Old Space]] · [[Mark-Sweep-Compact]]
- 응용: [[V8 GC]]
- Adjacent: [[Cheney's Algorithm]] · [[Object Pool]]
## 🤖 LLM 활용
**언제**: 매 GC pause 매 SLO 위협. 매 allocation profiling 매 hot path 식별. 매 V8 / JVM heap behavior 의 understanding.
**언제 X**: 매 Rust / C++ (no GC). 매 small script (default 면 충분). 매 micro-optimization 의 매 measurement 의 X.
## ❌ 안티패턴
- **매 frame 의 새 closure**: 매 frame 마다 매 object alloc → 매 Scavenge 폭발.
- **Long-lived array 의 매 push/splice**: 매 internal buffer 의 New Space alloc → promote.
- **TypedArray 의 매 매 new 만들기**: 매 reuse — 매 Float32Array 매 large allocation.
- **매 GC 의 force (`global.gc()`)**: 매 production 의 X — 매 V8 heuristic 의 disrupt.
- **매 NewRatio 매 production 의 변경 의 측정 없이**: 매 application-specific tuning — default 매 first.
## 🧪 검증 / 중복
- Verified (V8 design docs 2026-05, OpenJDK HotSpot source, Cheney 1970 paper).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Cheney scavenge + V8/JVM/.NET cross-platform comparison |
@@ -0,0 +1,171 @@
---
id: wiki-2026-0508-notebooklm-automated-authenticat
title: NotebookLM Automated Authentication CLI
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [notebooklm-cli, notebooklm-auto-auth]
duplicate_of: none
source_trust_level: A
confidence_score: 0.85
verification_status: applied
tags: [automation, oauth, cli, notebooklm, google]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Python/Node
framework: Playwright/OAuth2
---
# NotebookLM Automated Authentication CLI
## 매 한 줄
> **"매 NotebookLM 의 official API 부재 시 의 매 browser-automation 기반 인증 우회"**. 매 Google 의 OAuth scope 부족 + NotebookLM 매 web-only — 매 2026 의 community workaround 는 매 Playwright + cookie persistence + headless headful hybrid — 매 ToS gray-zone 의 주의 필요.
## 매 핵심
### 매 official 한계 (2026)
- 매 NotebookLM API 매 not GA — 매 Workspace partner 매 limited preview 만.
- 매 OAuth scope 매 notebooklm 부재.
- 매 Apps Script 매 access 매 X.
### 매 community workaround
1. 매 Playwright headful 매 첫 login → 매 cookie/storage_state save.
2. 매 subsequent run 매 headless + saved state.
3. 매 challenge / 2FA 매 hybrid (headful trigger when needed).
### 매 응용
1. 매 daily research digest 자동 ingest.
2. 매 source library 의 batch upload.
3. 매 podcast generation 의 schedule.
## 💻 패턴
### 매 first login + save state
```python
# auth_init.py — 매 1회 실행, 사용자 매 직접 login
from playwright.sync_api import sync_playwright
with sync_playwright() as p:
browser = p.chromium.launch(headless=False)
ctx = browser.new_context()
page = ctx.new_page()
page.goto("https://notebooklm.google.com/")
print("Sign in manually, then press Enter…")
input()
ctx.storage_state(path="state.json")
browser.close()
```
### 매 reuse session
```python
# run.py
from playwright.sync_api import sync_playwright
with sync_playwright() as p:
browser = p.chromium.launch(headless=True)
ctx = browser.new_context(storage_state="state.json")
page = ctx.new_page()
page.goto("https://notebooklm.google.com/")
page.wait_for_selector("text=Notebooks", timeout=15_000)
# … perform actions …
ctx.storage_state(path="state.json") # 매 refresh saved state
browser.close()
```
### 매 challenge fallback
```python
def goto_with_fallback(url, state_path="state.json"):
try:
ctx = browser.new_context(storage_state=state_path)
page = ctx.new_page(); page.goto(url)
page.wait_for_selector("text=Notebooks", timeout=10_000)
return page
except TimeoutError:
# 매 headful re-auth
browser2 = p.chromium.launch(headless=False)
ctx2 = browser2.new_context(storage_state=state_path)
page2 = ctx2.new_page(); page2.goto(url)
input("Resolve challenge, Enter…")
ctx2.storage_state(path=state_path)
return None
```
### 매 cookie expiry monitor
```python
import json, time
state = json.load(open("state.json"))
for c in state["cookies"]:
if c.get("expires", 0) and c["expires"] < time.time() + 86400:
print(f"WARN: {c['name']} expires soon")
```
### 매 cron job
```cron
# 매 every 6h refresh
0 */6 * * * cd /opt/nlm && /usr/bin/python3 run.py >> log 2>&1
```
### 매 docker secrets
```dockerfile
FROM mcr.microsoft.com/playwright/python:v1.45-jammy
WORKDIR /app
COPY *.py ./
# state.json 매 mount 의 secret
CMD ["python", "run.py"]
```
```bash
docker run --rm -v $(pwd)/state.json:/app/state.json:rw nlm-bot
```
### 매 multi-account
```python
ACCOUNTS = ["work", "personal"]
for acc in ACCOUNTS:
ctx = browser.new_context(storage_state=f"state-{acc}.json")
# ...
```
### 매 audit log
```python
import logging
logging.basicConfig(filename="audit.log", level=logging.INFO,
format="%(asctime)s %(message)s")
logging.info(f"login session reused, action={action}")
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 daily small batch | Playwright + state.json |
| 매 enterprise scale | Workspace API preview 의 신청 |
| 매 ToS-strict org | 매 official API 만 — automation 회피 |
| 매 2FA 매 strict | hybrid headful fallback |
**기본값**: 매 personal use — Playwright state-file pattern. 매 enterprise — official API 신청 + 대기.
## 🔗 Graph
- 부모: [[OAuth]]
- Adjacent: [[Secret_Management]]
## 🤖 LLM 활용
**언제**: 매 NotebookLM-driven research pipeline 의 자동화.
**언제 X**: 매 ToS 위반 우려 시 — 매 Workspace partner channel 사용.
## ❌ 안티패턴
- **state.json 매 git commit**: 매 session 의 leak.
- **2FA 매 bypass attempt**: 매 ToS violation + account ban.
- **headless 매 only**: 매 challenge 매 silent fail.
- **expiry 무시**: 매 cron 매 silent broken.
## 🧪 검증 / 중복
- Verified (Playwright 1.45+, NotebookLM 2026 web behavior).
- 신뢰도 A-.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Playwright 기반 NotebookLM 인증 자동화 패턴 |
@@ -0,0 +1,153 @@
---
id: wiki-2026-0508-oilpan
title: Oilpan
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Blink GC, cppgc, Oilpan GC]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [gc, c++, blink, chromium, memory-management]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C++
framework: Blink/Chromium, cppgc (V8)
---
# Oilpan
## 매 한 줄
> **"매 C++ object 매 trace-based GC"**. 매 2014 Blink (Chromium renderer) 의 DOM tree memory bug 해결 위해 도입 된 매 C++ GC. 매 2021 V8 의 매 cppgc 로 generalize 되어 매 Node.js native module / Dart VM 의 사용. 매 raw pointer 의 cycle leak 매 fundamental 해결.
## 매 핵심
### 매 motivation
- 매 DOM tree 매 cyclic reference (parent ↔ child) 매 매우 흔함.
- 매 RefCounted (smart pointer) 의 cycle 매 leak.
- 매 manual `delete` 매 use-after-free / double-free 폭발.
- 매 Blink 매 2010-2014 매 매 brutal memory bug 매 routine.
### 매 Oilpan 동작
- 매 `GarbageCollected<T>` base class 매 inherit → 매 GC 의 manage.
- 매 `Member<T>` smart pointer 매 GC-tracked field 매 declare.
- 매 `Trace(Visitor*)` virtual method 매 reachability 의 manual report.
- 매 incremental marking + concurrent sweeping → 매 main thread pause < 1ms.
### 매 응용
1. Blink DOM (Element, Node, Document) 매 모든 lifecycle.
2. V8 cppgc 매 사용 한 매 Node.js native addon.
3. Dart VM heap.
4. Skia paint object graph (experimental).
## 💻 패턴
### 1. Garbage-collected class
```cpp
#include "v8/cppgc/garbage-collected.h"
#include "v8/cppgc/member.h"
class Node : public cppgc::GarbageCollected<Node> {
public:
void Trace(cppgc::Visitor* visitor) const {
visitor->Trace(parent_);
visitor->Trace(children_);
}
private:
cppgc::Member<Node> parent_;
cppgc::HeapVector<cppgc::Member<Node>> children_;
};
```
### 2. Allocation
```cpp
auto* node = cppgc::MakeGarbageCollected<Node>(heap.GetAllocationHandle());
// 매 delete 의 X — GC 가 reclaim
```
### 3. Persistent (off-heap reference)
```cpp
class NonGcOwner {
cppgc::Persistent<Node> root_; // 매 strong root
cppgc::WeakPersistent<Node> observer_; // 매 weak (clear 시 nullptr)
};
```
### 4. Pre-finalizer (cleanup hook)
```cpp
class Resource : public cppgc::GarbageCollected<Resource> {
USING_PRE_FINALIZER(Resource, Dispose);
void Dispose() {
// 매 GC 직전 호출 — 매 file handle close 등
if (fd_ >= 0) close(fd_);
}
void Trace(cppgc::Visitor*) const {}
private:
int fd_ = -1;
};
```
### 5. Cross-thread safety
```cpp
// 매 GC heap 매 single thread (renderer main).
// 매 worker → main thread post 매 cppgc::CrossThreadPersistent.
cppgc::CrossThreadPersistent<Node> handle(node);
PostTaskToMain([handle]() {
handle->DoSomething();
});
```
### 6. Heap stats (debugging)
```cpp
auto stats = heap.CollectStatistics(cppgc::HeapStatistics::DetailLevel::kDetailed);
LOG(INFO) << "Resident: " << stats.resident_size_bytes
<< " Used: " << stats.used_size_bytes;
```
### 7. Force GC (test only)
```cpp
heap.ForceGarbageCollectionSlow(
"test", "explicit",
cppgc::Heap::StackState::kNoHeapPointers);
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Acyclic ownership | `unique_ptr` / `shared_ptr` (no GC needed) |
| Cyclic graph (DOM-like) | Oilpan / cppgc |
| Latency-critical realtime | Avoid — GC pause unpredictable |
| Cross-language boundary (V8) | cppgc 매 V8 와 매 unified heap |
| Embedded / no V8 | Standalone cppgc library |
**기본값**: 매 cycle 가능 한 graph 에서만 Oilpan. 매 simple ownership 매 RAII.
## 🔗 Graph
- 부모: [[Garbage Collection]] · [[Tracing GC]]
- 변형: [[V8 GC]] · [[Mark-Sweep-Compact]]
- Adjacent: [[Tri-color Marking]] · [[Reference Counting]]
## 🤖 LLM 활용
**언제**: 매 C++ project 에서 매 cyclic object graph 매 unavoidable. 매 V8 embedder 매 native object 와 JS object 의 unified GC.
**언제 X**: 매 simple resource ownership (RAII 매 충분). 매 hard real-time. 매 embedded (memory budget tight).
## ❌ 안티패턴
- **Raw pointer 매 GC heap object 매 hold**: 매 GC 가 collect → use-after-free. 매 항상 Member/Persistent.
- **Trace 매 incomplete**: 매 missed field 매 premature collection. 매 Clang plugin 매 lint check 활용.
- **Pre-finalizer 매 heavy work**: 매 GC 의 pause 증가. 매 light cleanup 만.
- **Cross-thread 매 raw Member**: 매 data race + 매 GC 의 oblivious. 매 CrossThreadPersistent 사용.
- **Stack 의 conservative scan 의 abuse**: 매 false retention. 매 kNoHeapPointers state 매 가능 한 사용.
## 🧪 검증 / 중복
- Verified (V8 cppgc docs, Blink rendering core 2026-05, Dart VM source).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Oilpan/cppgc unified heap + Member/Persistent pattern |
@@ -0,0 +1,179 @@
---
id: wiki-2026-0508-pdf-format
title: PDF Format
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Portable Document Format, ISO 32000, PDF/A]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [pdf, document, format, parsing, generation]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: pypdf
---
# PDF Format
## 매 한 줄
> **"매 cross-reference table 의 random-access 의 binary container"**. 매 Adobe (1993) 의 PostScript-derived 의 ISO 32000 의 standardize 의 page-fixed-layout 의 dominant interchange format. 매 2026 년 의 PDF/A-4 (archival) + PDF 2.0 의 modern variant 의 LLM-extraction 의 challenge 의 source (no semantic structure 의 guarantee).
## 매 핵심
### 매 file 구조
1. **Header** — `%PDF-2.0` (또는 1.x).
2. **Body** — sequence of indirect objects (`N G obj ... endobj`).
3. **Cross-reference table** (`xref`) — byte offset of each object.
4. **Trailer** — root + info + size + xref offset.
### 매 object types
- Boolean, Number, String (literal `()` or hex `<>`), Name (`/Name`), Array, Dictionary, Stream (filtered binary).
- Page tree (Catalog → Pages → Page) + Resources (Font, XObject, etc.).
### 매 응용
1. Text/table extraction (LLM 의 RAG ingest).
2. Form fill (AcroForm / XFA).
3. Digital signature (PAdES).
4. Print fidelity (PDF/X for press).
5. Archive (PDF/A — embed fonts, no encryption).
## 💻 패턴
### Text extraction (pypdf, 2026)
```python
from pypdf import PdfReader
reader = PdfReader("doc.pdf")
text = ""
for page in reader.pages:
text += page.extract_text() + "\n"
# pypdf 5.x: layout-mode option for column-aware
text = "\n".join(p.extract_text(extraction_mode="layout") for p in reader.pages)
```
### Better extraction with pdfplumber (preserves layout)
```python
import pdfplumber
with pdfplumber.open("doc.pdf") as pdf:
for page in pdf.pages:
# Tables
for table in page.extract_tables():
print(table)
# Words with bbox
for word in page.extract_words():
print(word['text'], word['x0'], word['top'])
```
### LLM-grade extraction with Unstructured (2026)
```python
from unstructured.partition.pdf import partition_pdf
elements = partition_pdf(
filename="doc.pdf",
strategy="hi_res", # uses layout model
infer_table_structure=True,
extract_images_in_pdf=True,
)
# Each element: Title, NarrativeText, Table, Image
```
### Generate PDF (reportlab)
```python
from reportlab.lib.pagesizes import A4
from reportlab.pdfgen import canvas
c = canvas.Canvas("out.pdf", pagesize=A4)
c.setFont("Helvetica-Bold", 16)
c.drawString(72, 800, "Invoice #1234")
c.setFont("Helvetica", 10)
for i, line in enumerate(items):
c.drawString(72, 760 - i*14, line)
c.showPage()
c.save()
```
### Modern HTML→PDF (Playwright, replaces wkhtmltopdf)
```python
from playwright.async_api import async_playwright
async def html_to_pdf(html, out):
async with async_playwright() as p:
browser = await p.chromium.launch()
page = await browser.new_page()
await page.set_content(html)
await page.pdf(path=out, format="A4", print_background=True)
await browser.close()
```
### Sign PDF (PAdES, pyhanko)
```python
from pyhanko.sign import signers, fields
from pyhanko.pdf_utils.incremental_writer import IncrementalPdfFileWriter
with open("input.pdf", "rb") as inf:
w = IncrementalPdfFileWriter(inf)
fields.append_signature_field(w, sig_field_spec=fields.SigFieldSpec("Sig1", box=(50, 50, 200, 100)))
signer = signers.SimpleSigner.load("cert.pem", "key.pem")
with open("signed.pdf", "wb") as out:
signers.sign_pdf(w, signers.PdfSignatureMetadata(field_name="Sig1"), signer=signer, output=out)
```
### Repair / linearize (qpdf CLI)
```bash
qpdf --linearize input.pdf output.pdf
qpdf --object-streams=generate --compress-streams=y input.pdf small.pdf
qpdf --check input.pdf # validate xref + structure
```
### Encrypted PDF
```python
from pypdf import PdfWriter
writer = PdfWriter(clone_from="doc.pdf")
writer.encrypt(user_password="user", owner_password="owner", algorithm="AES-256")
with open("encrypted.pdf", "wb") as f:
writer.write(f)
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| Text extraction (simple) | pypdf 5.x |
| Layout / tables | pdfplumber |
| LLM RAG ingest | Unstructured + hi_res / Marker / Docling |
| Generation (reports) | reportlab / WeasyPrint |
| HTML → PDF (modern) | Playwright (Chrome headless) |
| Forms / signing | pyhanko + qpdf |
| Repair / optimize | qpdf, mutool |
**기본값**: 매 ingest → Unstructured (layout-aware), 매 generate → Playwright (HTML).
## 🔗 Graph
- 응용: [[Document AI]]
- Adjacent: [[OCR]]
## 🤖 LLM 활용
**언제**: 매 form-filled PDF 의 question. 매 extraction tool 의 selection. 매 schema mapping.
**언제 X**: 매 binary blob 의 direct edit 의 LLM 의 X. 매 spec-conformant tool 의 use.
## ❌ 안티패턴
- **Regex-based PDF parsing**: 매 binary + xref 의 fragile. 매 lib 의 사용.
- **Single extraction strategy**: 매 scanned PDF 의 OCR fallback. 매 hi_res strategy.
- **No PDF/A for archive**: 매 font 의 missing 의 future render fail.
## 🧪 검증 / 중복
- Verified (ISO 32000-2:2020, pypdf docs, Unstructured docs, qpdf manual).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — PDF structure + 2026 extraction/generation toolchain |
@@ -0,0 +1,169 @@
---
id: wiki-2026-0508-page-experience-algorithm
title: Page Experience Algorithm
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Google Page Experience, Core Web Vitals ranking, INP]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [seo, web-performance, core-web-vitals, google]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: N/A
framework: Google Search Ranking
---
# Page Experience Algorithm
## 매 한 줄
> **"매 Google 의 ranking signal 으로서 의 매 user perceived UX metric"**. 매 2021 Page Experience update 매 mobile 적용, 매 2022 desktop 확장, 매 2024-03 매 FID → INP 교체. 매 2026 의 매 core signal: LCP / INP / CLS + HTTPS / mobile-friendly / no-intrusive-interstitial.
## 매 핵심
### 매 Core Web Vitals (2026)
- **LCP (Largest Contentful Paint)**: 매 viewport 의 매 largest element render 시간. **Good < 2.5s**.
- **INP (Interaction to Next Paint)**: 매 모든 interaction 의 매 max latency (75th percentile). **Good < 200ms**.
- **CLS (Cumulative Layout Shift)**: 매 unexpected layout shift 누적 score. **Good < 0.1**.
### 매 추가 signal
- HTTPS 적용.
- Mobile-friendly (responsive).
- No intrusive interstitial (popup ad coverage).
- (deprecated 2024-03) Safe Browsing — 매 separate signal.
### 매 측정 source
- **CrUX (Chrome UX Report)**: 매 28-day rolling RUM data, 매 actual ranking signal.
- **PageSpeed Insights**: 매 lab + field 결합 view.
- **Search Console > Core Web Vitals report**.
- **web-vitals.js**: 매 self-RUM library.
### 매 응용
1. SEO ranking 향상.
2. Conversion rate 개선 (slow → bounce).
3. AdSense ad serving quality.
4. Discover feed 노출 자격.
## 💻 패턴
### 1. web-vitals.js 측정
```ts
import { onLCP, onINP, onCLS } from 'web-vitals';
onLCP((metric) => sendToAnalytics('LCP', metric));
onINP((metric) => sendToAnalytics('INP', metric));
onCLS((metric) => sendToAnalytics('CLS', metric));
function sendToAnalytics(name: string, metric: any) {
navigator.sendBeacon('/rum', JSON.stringify({
name, value: metric.value, id: metric.id, rating: metric.rating
}));
}
```
### 2. LCP 최적화 — preload hero image
```html
<link rel="preload" as="image"
href="/hero.webp"
fetchpriority="high"
imagesrcset="/hero-800.webp 800w, /hero-1600.webp 1600w"
imagesizes="100vw">
```
### 3. INP 최적화 — long task break
```ts
async function processLargeList(items: Item[]) {
for (let i = 0; i < items.length; i++) {
process(items[i]);
if (i % 50 === 0) {
await scheduler.yield(); // 매 2026 Scheduler API
}
}
}
```
### 4. CLS 방지 — explicit dimensions
```html
<img src="/photo.webp" width="800" height="600" alt="...">
<iframe src="..." width="560" height="315"></iframe>
<!-- font swap reserve space -->
<style>
@font-face {
font-family: "Inter";
src: url(/inter.woff2) format("woff2");
size-adjust: 100%;
ascent-override: 90%;
font-display: swap;
}
</style>
```
### 5. Defer non-critical JS
```html
<script src="/analytics.js" defer></script>
<script type="module" src="/app.js"></script>
<script src="/legacy.js" nomodule defer></script>
```
### 6. Resource hints
```html
<link rel="preconnect" href="https://cdn.example.com" crossorigin>
<link rel="dns-prefetch" href="https://api.example.com">
<link rel="modulepreload" href="/critical-module.js">
```
### 7. CrUX API query (BigQuery)
```sql
SELECT
origin,
largest_contentful_paint.histogram.density AS lcp_density,
interaction_to_next_paint.histogram.density AS inp_density
FROM `chrome-ux-report.materialized.country_summary`
WHERE country_code = 'kr'
AND yyyymm = 202604
AND device = 'phone'
AND origin = 'https://example.com';
```
## 매 결정 기준
| 상황 | Priority |
|---|---|
| LCP > 4s | Hero image preload + fetchpriority=high (매 first) |
| INP > 500ms | React 18+ concurrent + scheduler.yield() (매 2번째) |
| CLS > 0.25 | Image dimensions + font swap stabilization (매 quick win) |
| All green but slow ranking | Beyond CWV — content quality matters |
| Mobile-only fail | Test 매 mobile network throttle (Slow 4G) |
**기본값**: web-vitals.js + Lighthouse CI + CrUX field monitoring 의 매 weekly review.
## 🔗 Graph
- 부모: [[SEO]] · [[Web Performance]]
- 변형: [[Lighthouse]]
- 응용: [[Core Web Vitals Optimization (INP, LCP, CLS)|Core Web Vitals]]
- Adjacent: [[Lighthouse CI]] · [[PageSpeed Insights]]
## 🤖 LLM 활용
**언제**: 매 SEO-driven traffic 매 critical (e-commerce, news, blog). 매 ranking 매 stagnant + 매 lab metric 양호 한 경우.
**언제 X**: 매 internal tool / B2B SaaS (organic search 매 minor). 매 ranking 의 매 dominant signal 의 X — 매 content 매 first.
## ❌ 안티패턴
- **Lab metric 만 monitor**: 매 PageSpeed score 100 + 매 field CrUX poor — 매 real users 의 perspective 누락.
- **75th percentile 무시**: 매 mean / median 매 deceiving — 매 long tail 매 ranking 결정.
- **INP 의 무시**: 매 2024-03 부터 매 FID 대체 — 매 legacy site 매 INP regression 매 routine.
- **CLS shift container 매 transform 으로 회피**: 매 actual layout 매 jarring — 매 reserved space 가 매 정답.
- **Preload 의 abuse**: 매 모든 image preload → 매 critical asset 매 starve.
## 🧪 검증 / 중복
- Verified (web.dev/vitals 2026-05, Google Search Central 공식 docs, CrUX dataset).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — INP-replaces-FID + 2026 Scheduler API yield pattern |
@@ -0,0 +1,200 @@
---
id: wiki-2026-0508-parse-dont-validate
title: Parse, Don't Validate
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [parse don't validate, type-driven design, smart constructor, refinement type]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [type-system, design, haskell, typescript, validation]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript/Haskell
framework: Zod, Effect, Brand types
---
# Parse, Don't Validate
## 매 한 줄
> **"매 unsafe input 매 한번 parse → 매 typed value 매 produce, 매 downstream 매 다시 검증 의 X"**. 매 2019 Alexis King (lexi-lambda) 의 Haskell post 의 origin. 매 핵심 idea: 매 validation 매 boolean 의 throw — 매 information 의 lose. 매 parsing 매 validated 형식 의 새 type 의 produce — 매 type system 의 매 invariant 의 carry.
## 매 핵심
### 매 validate 의 problem
```ts
// 매 anti-pattern
function isNonEmpty<T>(arr: T[]): boolean { return arr.length > 0; }
function head<T>(arr: T[]): T {
if (!isNonEmpty(arr)) throw new Error("empty!");
return arr[0]; // 매 type system 매 still T | undefined
}
```
- 매 `isNonEmpty` check 후 매 type 매 `T[]` (그대로) — 매 information lost.
- 매 head 매 매번 다시 check or throw.
- 매 caller 매 invariant 의 untracked.
### 매 parse 의 solution
```ts
type NonEmpty<T> = readonly [T, ...T[]];
function parseNonEmpty<T>(arr: T[]): NonEmpty<T> | null {
return arr.length > 0 ? (arr as NonEmpty<T>) : null;
}
function head<T>(arr: NonEmpty<T>): T {
return arr[0]; // 매 항상 safe — type system 의 guarantee
}
```
- 매 parse 결과 매 새 type — 매 invariant 가 매 type 에 baked in.
- 매 downstream 매 trust — 매 re-check 의 X.
### 매 응용
1. API request body validation (Zod / Effect Schema).
2. ID type discrimination (UserId vs OrderId).
3. URL / Email parsing.
4. Smart constructor (private constructor + parse function).
5. Domain modeling (PositiveNumber, NonEmptyString).
## 💻 패턴
### 1. Branded type (TypeScript)
```ts
type Brand<T, B> = T & { readonly __brand: B };
type Email = Brand<string, 'Email'>;
function parseEmail(s: string): Email | null {
return /^[^\s@]+@[^\s@]+\.[^\s@]+$/.test(s) ? (s as Email) : null;
}
function sendMail(to: Email, body: string) { /* 매 trust to */ }
const raw = "user@example.com";
const email = parseEmail(raw);
if (!email) throw new Error("bad email");
sendMail(email, "hi"); // 매 OK
sendMail(raw, "hi"); // 매 type error
```
### 2. Zod schema (parse-style)
```ts
import { z } from 'zod';
const UserSchema = z.object({
id: z.string().uuid(),
email: z.string().email(),
age: z.number().int().min(0).max(150),
});
type User = z.infer<typeof UserSchema>; // 매 fully-typed
app.post('/users', (req, res) => {
const result = UserSchema.safeParse(req.body);
if (!result.success) return res.status(400).json(result.error);
createUser(result.data); // 매 trust — User type 매 guaranteed
});
```
### 3. Effect Schema (2026 의 매 modern)
```ts
import { Schema as S } from "effect";
const PositiveInt = S.Int.pipe(S.positive(), S.brand("PositiveInt"));
type PositiveInt = S.Schema.Type<typeof PositiveInt>;
const decode = S.decodeUnknownSync(PositiveInt);
const x = decode(42); // 매 PositiveInt
const y = decode(-1); // 매 throws ParseError
```
### 4. Smart constructor (Haskell-style)
```ts
class NonEmptyList<T> {
private constructor(public readonly items: readonly T[]) {}
static parse<T>(items: readonly T[]): NonEmptyList<T> | null {
return items.length > 0 ? new NonEmptyList(items) : null;
}
get head(): T { return this.items[0]; } // 매 always safe
get tail(): readonly T[] { return this.items.slice(1); }
}
```
### 5. Discriminated ID type
```ts
type UserId = Brand<string, 'UserId'>;
type OrderId = Brand<string, 'OrderId'>;
function getUser(id: UserId): User { /*...*/ }
function getOrder(id: OrderId): Order { /*...*/ }
const uid = parseUserId(req.params.id);
if (!uid) throw new Error();
getUser(uid); // 매 OK
getOrder(uid); // 매 type error 매 prevent mix-up
```
### 6. Parse at boundary, trust within
```ts
// 매 boundary (HTTP / DB / file IO)
const userOrErr = UserSchema.safeParse(rawJson);
// 매 internal — User type 매 항상 valid
function processUser(u: User) {
// 매 u.email 매 valid email — 매 re-check 의 X
// 매 u.age 매 0-150 매 — 매 re-check 의 X
}
```
### 7. Refinement chain
```ts
const NonEmptyString = z.string().min(1).brand<'NonEmptyString'>();
const EmailString = NonEmptyString.refine(
s => /^[^@]+@[^@]+$/.test(s)
).brand<'Email'>();
type Email = z.infer<typeof EmailString>;
```
## 매 결정 기준
| 상황 | Apply parse-don't-validate? |
|---|---|
| Trust boundary (HTTP / DB / file) | Yes — 매 must |
| ID across multiple types | Yes — 매 brand to prevent mix |
| Hot path internal-only | Optional — perf trade-off |
| Quick script / prototype | Skip — overhead > value |
| Domain primitive (Money, Date) | Yes — 매 invariant carrying |
**기본값**: 매 boundary 의 매 Zod (or Effect Schema) parse + 매 internal 의 매 inferred type 으로 trust.
## 🔗 Graph
- 부모: [[Type-Driven Design]]
- 변형: [[Refinement Type]] · [[Smart Constructor]]
- 응용: [[Zod]] · [[Effect Schema]] · [[Branded Type]]
- Adjacent: [[Validation]] · [[Type Narrowing]]
## 🤖 LLM 활용
**언제**: 매 API server / public library 의 매 input validation. 매 ID mix-up bug 매 routine 한 codebase. 매 domain rule 매 type-encode 가능 한 경우.
**언제 X**: 매 internal-only quick script. 매 highly dynamic JSON 의 schema 가 unknown. 매 perf-critical hot loop (parse overhead).
## ❌ 안티패턴
- **Validate 후 raw type 의 pass**: 매 invariant 매 lose. 매 항상 새 type 의 return.
- **Parse 매 boundary X 의 매 매 layer 의 repeat**: 매 perf 손실 + 매 동일 logic 의 duplicate.
- **Brand 의 매 runtime check 의 X**: 매 cast 매 type-only — 매 parse function 매 항상 runtime check 포함.
- **Optional 의 abuse**: 매 `email?: string` — 매 invariant 매 unclear. 매 명확한 `Email | null`.
- **Throw on parse fail (preference)**: 매 Result type / safeParse 의 매 prefer — 매 caller flow 매 explicit.
## 🧪 검증 / 중복
- Verified (Alexis King "Parse, Don't Validate" 2019, Zod 4 / Effect 3.x docs 2026-05).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Branded types + Zod/Effect Schema 의 modern parse pattern |
@@ -0,0 +1,206 @@
---
id: wiki-2026-0508-practical-cryptography
title: Practical Cryptography
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Applied Cryptography, Crypto Engineering]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [cryptography, security, encryption]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Python/Go
framework: libsodium/cryptography
---
# Practical Cryptography
## 매 한 줄
> **"매 don't roll your own crypto"**. 매 application engineer 의 task 는 매 well-vetted primitives (AES-GCM, ChaCha20-Poly1305, Ed25519, X25519) 의 correct composition — 매 algorithm 의 invention 아님. 2026 의 modern stack 은 libsodium, AWS KMS, age, Noise Protocol Framework 위 의 build.
## 매 핵심
### 매 Primitives (2026 baseline)
- **Symmetric AEAD**: ChaCha20-Poly1305 (mobile/no-AES-NI), AES-256-GCM (server with AES-NI), AES-256-GCM-SIV (nonce-misuse resistant).
- **Asymmetric**: X25519 (ECDH key agreement), Ed25519 (signing), Kyber-1024 (post-quantum KEM, NIST FIPS 203).
- **Hashing**: BLAKE3 (fast), SHA-256 (interop), Argon2id (password hashing, 2026 default).
- **Key derivation**: HKDF-SHA256 (key expansion), Argon2id (password → key).
### 매 Threat models
- **Confidentiality**: encrypt-then-MAC, AEAD prevents IND-CCA2 attacks.
- **Integrity**: HMAC, Poly1305, signatures.
- **Authenticity**: signatures (Ed25519), authenticated key exchange (Noise).
- **Forward secrecy**: ephemeral keys (X25519 per session).
- **Post-quantum**: hybrid Kyber + X25519 (2026 TLS 1.3 default).
### 매 응용
1. TLS 1.3 (transport security).
2. Signal Protocol (E2EE messaging — Double Ratchet).
3. age/rage (file encryption — replaces GPG).
4. JWT/PASETO (stateless tokens — PASETO preferred).
5. Password storage (Argon2id with per-user salt).
## 💻 패턴
### AEAD encryption (ChaCha20-Poly1305 with libsodium)
```python
from nacl.secret import SecretBox
from nacl.utils import random
key = random(SecretBox.KEY_SIZE) # 32 bytes
box = SecretBox(key)
# Encrypt — nonce auto-generated, prepended to ciphertext
ciphertext = box.encrypt(b"sensitive data")
# Decrypt — fails with CryptoError on tampering
plaintext = box.decrypt(ciphertext)
```
### Authenticated key exchange (X25519 + HKDF)
```python
from cryptography.hazmat.primitives.asymmetric.x25519 import X25519PrivateKey
from cryptography.hazmat.primitives.kdf.hkdf import HKDF
from cryptography.hazmat.primitives import hashes
# Each party generates ephemeral keypair
alice_priv = X25519PrivateKey.generate()
bob_priv = X25519PrivateKey.generate()
# Compute shared secret
shared = alice_priv.exchange(bob_priv.public_key())
# Derive symmetric key — never use raw DH output as key
session_key = HKDF(
algorithm=hashes.SHA256(),
length=32,
salt=None,
info=b"session-v1",
).derive(shared)
```
### Password hashing (Argon2id)
```python
from argon2 import PasswordHasher
ph = PasswordHasher(
time_cost=3, # iterations
memory_cost=65536, # 64 MiB
parallelism=4,
)
hash = ph.hash("user-password") # store this
# Verify (constant-time)
try:
ph.verify(hash, "user-password")
if ph.check_needs_rehash(hash):
new_hash = ph.hash("user-password") # parameter upgrade
except VerifyMismatchError:
raise AuthError()
```
### Digital signature (Ed25519)
```python
from cryptography.hazmat.primitives.asymmetric.ed25519 import Ed25519PrivateKey
priv = Ed25519PrivateKey.generate()
pub = priv.public_key()
signature = priv.sign(b"message")
pub.verify(signature, b"message") # raises InvalidSignature on failure
```
### Envelope encryption (KMS pattern)
```python
import boto3
from cryptography.fernet import Fernet
kms = boto3.client("kms")
def encrypt_blob(plaintext: bytes, kms_key_id: str) -> dict:
# Generate per-message data key
resp = kms.generate_data_key(KeyId=kms_key_id, KeySpec="AES_256")
data_key = resp["Plaintext"]
encrypted_dk = resp["CiphertextBlob"]
# Encrypt data with data key, discard plaintext data key
f = Fernet(base64.urlsafe_b64encode(data_key))
ct = f.encrypt(plaintext)
return {"ciphertext": ct, "encrypted_key": encrypted_dk}
```
### Constant-time comparison
```python
import hmac
# WRONG — leaks length info via timing
if user_token == stored_token:
pass
# RIGHT — constant time
if hmac.compare_digest(user_token, stored_token):
pass
```
### Post-quantum hybrid KEM (2026)
```python
# liboqs-python — hybrid X25519 + Kyber768
from oqs import KeyEncapsulation
import nacl.public
# Classical X25519
x_priv = nacl.public.PrivateKey.generate()
# Post-quantum Kyber
with KeyEncapsulation("Kyber768") as kem:
pq_pub = kem.generate_keypair()
# Combine both shared secrets via HKDF for hybrid security
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| File encryption | age (modern), libsodium SecretBox |
| Password hash | Argon2id (never bcrypt for new systems) |
| Token format | PASETO v4 (Ed25519) over JWT |
| Mobile/IoT AEAD | ChaCha20-Poly1305 |
| TLS 1.3 backend | rustls or BoringSSL, hybrid PQ enabled |
| Signing | Ed25519 (never RSA for new systems) |
**기본값**: libsodium + Argon2id + Ed25519 + ChaCha20-Poly1305.
## 🔗 Graph
- 부모: [[Practical-Cryptography|Cryptography]] · [[Security]]
- 변형: [[보안 및 시스템 신뢰성 표준|Symmetric-Encryption]]
- 응용: [[Secret_Management]] · [[보안 및 시스템 신뢰성 표준|Zero-Trust Architecture]]
- Adjacent: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]] · [[Practical-Cryptography]]
## 🤖 LLM 활용
**언제**: explain primitive choice, audit crypto code for misuse, suggest migration paths.
**언제 X**: never ask LLM to design new protocol — always defer to peer-reviewed designs (Noise, Signal).
## ❌ 안티패턴
- **Roll-your-own**: custom XOR-based "encryption" — 매 broken in seconds.
- **ECB mode**: leaks pattern (penguin image meme). Always GCM/CTR/CBC-with-MAC.
- **Static IV/nonce**: catastrophic for GCM (key recovery). Always random or counter.
- **MD5/SHA-1**: collision-broken. Never for security purposes.
- **bcrypt for new systems**: Argon2id 2026 default.
- **String comparison for tokens**: use `hmac.compare_digest`.
## 🧪 검증 / 중복
- Verified (NIST FIPS 203/204/205, RFC 9180 HPKE, libsodium docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — full primitives + 2026 PQ baseline |
@@ -0,0 +1,156 @@
---
id: wiki-2026-0508-prettier
title: Prettier
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Prettier Formatter, Code Formatter]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [tooling, formatter, javascript, typescript]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: JavaScript/TypeScript
framework: Prettier
---
# Prettier
## 매 한 줄
> **"매 opinionated formatter — 매 bikeshed 종결자"**. Prettier 매 AST re-print 방식 사용 — 매 source 의 whitespace 무시 의 deterministic output 생성. 2026 매 v3.x 의 ESM-first + plugin ecosystem 안정화.
## 매 핵심
### 매 Re-print 방식
- 매 parser 의 source → AST 변환.
- 매 printer 의 AST → IR (Doc) 생성.
- 매 IR 의 line-width constraint 기반 layout 결정.
- 매 original whitespace 의 X 보존.
### 매 ESLint 와의 분리
- ESLint: 매 code quality (logic, anti-patterns).
- Prettier: 매 formatting (whitespace, quote, line-break).
- 매 `eslint-config-prettier` 의 conflict rule disable.
### 매 응용
1. 매 monorepo 의 unified formatting.
2. CI 의 `--check` mode — 매 format violation 의 fail.
3. Pre-commit hook (`lint-staged` + `husky`) 의 auto-format.
## 💻 패턴
### Config 의 minimal `.prettierrc`
```json
{
"semi": true,
"singleQuote": true,
"trailingComma": "all",
"printWidth": 100,
"tabWidth": 2,
"arrowParens": "always",
"endOfLine": "lf"
}
```
### CLI 의 batch format
```bash
# Format in place
npx prettier --write "src/**/*.{ts,tsx,js,jsx,json,md}"
# CI check
npx prettier --check "src/**/*.{ts,tsx}"
```
### lint-staged 의 staged-only format
```json
// package.json
{
"lint-staged": {
"*.{ts,tsx,js,jsx}": [
"prettier --write",
"eslint --fix"
]
}
}
```
### Plugin 의 ordering — `prettier-plugin-tailwindcss`
```json
{
"plugins": ["prettier-plugin-tailwindcss"]
}
// Tailwind class 의 자동 ordering — flex p-4 m-2 → m-2 p-4 flex
```
### Programmatic API (v3 ESM)
```typescript
import prettier from "prettier";
const formatted = await prettier.format(sourceCode, {
parser: "typescript",
semi: false,
singleQuote: true,
});
```
### Editor integration — VSCode
```json
// .vscode/settings.json
{
"editor.defaultFormatter": "esbenp.prettier-vscode",
"editor.formatOnSave": true,
"[typescript]": { "editor.defaultFormatter": "esbenp.prettier-vscode" }
}
```
### Override 의 file-type 별 config
```json
{
"semi": true,
"overrides": [
{ "files": "*.md", "options": { "proseWrap": "always", "printWidth": 80 } },
{ "files": "*.yml", "options": { "tabWidth": 2 } }
]
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Solo project | Prettier defaults — 매 zero config. |
| Team — strict | `.prettierrc` commit + CI check. |
| Tailwind 사용 | `prettier-plugin-tailwindcss` 필수. |
| Legacy codebase | 매 한 번 `--write` + 매 `.git-blame-ignore-revs` 추가. |
| Monorepo | Root `.prettierrc` + workspace override. |
**기본값**: `singleQuote: true`, `trailingComma: "all"`, `printWidth: 100`, format-on-save + pre-commit hook.
## 🔗 Graph
- 부모: [[Code Formatting]]
- 변형: [[ESLint]] · [[Biome]]
- 응용: [[153_pre-commit과_품질_게이트|Pre-commit Hooks]] · [[lint-staged]]
- Adjacent: [[AST]] · [[TypeScript]]
## 🤖 LLM 활용
**언제**: JS/TS/JSON/MD/YAML/CSS — 매 multi-language project 의 unified formatting.
**언제 X**: 매 Rust/Go (rustfmt/gofmt 의 사용), 매 single-language Rust-only 의 Biome 고려.
## ❌ 안티패턴
- **ESLint 의 stylistic rules + Prettier 동시 사용**: 매 conflict 발생 → `eslint-config-prettier` 적용.
- **`.prettierrc` 의 commit X**: 매 team 의 inconsistent format.
- **Format-on-save 의 X + manual format**: 매 review noise 증가.
- **매 large initial format 의 main branch 직접 commit**: blame 의 손상 — 매 `.git-blame-ignore-revs` 사용.
## 🧪 검증 / 중복
- Verified (Prettier docs v3.x).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Prettier 매 re-print formatter + config patterns 정리 |
@@ -0,0 +1,158 @@
---
id: wiki-2026-0508-procedural-rhetoric
title: Procedural Rhetoric
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Persuasive Games, Computational Rhetoric]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [rhetoric, game-design, persuasion]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: design
framework: Bogost framework
---
# Procedural Rhetoric
## 매 한 줄
> **"매 argument 의 made not by words, but by rules"**. Ian Bogost 의 *Persuasive Games* (2007) 의 coined — 매 systems/processes/simulations 의 medium 의 argumentation. 2026 의 LLM-driven dynamic narrative + simulation games (Civ VII, FrostPunk 2) 의 procedural rhetoric 의 mainstream.
## 매 핵심
### 매 Bogost's framework
- **Verbal rhetoric**: words, written/spoken.
- **Visual rhetoric**: images, layout, color.
- **Procedural rhetoric**: rules, systems, feedback loops.
- 매 game 의 unique medium — 매 "what you do" expresses argument.
### 매 Mechanisms
- **Constraint**: what you can't do says as much as what you can.
- **Feedback loops**: reward shapes belief about what matters.
- **Simulation gap**: simplifications reveal designer assumptions.
- **Failure states**: what counts as losing encodes values.
- **Resource economy**: scarcity → priorities.
- **Agency vs. determinism**: how much player matters.
### 매 Examples
- **September 12th** (Frasca): bombing terrorists creates more terrorists.
- **PeaceMaker**: Israeli-Palestinian dual-perspective.
- **Papers, Please**: bureaucratic complicity, moral fatigue.
- **This War of Mine**: civilian war experience.
- **FrostPunk**: authoritarianism as survival logic.
- **Civilization**: progress narrative encoded in tech tree.
- **Cookie Clicker**: critique of incremental design.
### 매 응용
1. Serious games (training, education).
2. News games (Bloomberg's Build the wall vs Don't, NYT graphics).
3. Activist games (climate, refugees).
4. Marketing simulations.
5. AI-driven dynamic narrative (2026 Inworld, Convai).
## 💻 패턴
### Encoding argument as mechanic
```
Argument: "Bureaucracy dehumanizes"
Mechanic: Time pressure + paperwork + small reward for thoroughness, big penalty for missing detail
Result: Player feels the dehumanization rather than reads about it
→ Papers, Please
```
### Resource scarcity as ideology
```
Argument: "Survival justifies authoritarianism"
Mechanic: Heat ↓ over time, citizens demand law book, only authoritarian laws prevent extinction
Result: Player chooses oppression "rationally"
→ FrostPunk
```
### Simplification as critique
```typescript
// Climate simulator: emissions only knob
// By omitting "carbon offsets", "green tech", argues these are insufficient distractions
const tempAtYear = (year: number, emissions: number) =>
baseline + emissions * year * sensitivity;
// What's missing IS the rhetoric
```
### LLM-driven NPC dialogue (2026)
```typescript
// Inworld-style: NPC values encoded as system prompt + memory
// The game's argument now adapts to player — emergent procedural rhetoric
const npcPrompt = `
You are a refugee in an unnamed conflict.
Your values: family safety > nation > ideology.
You distrust both sides equally.
Respond based on the player's prior actions: ${recentActions.join(', ')}.
`;
// The NPC's reactive logic IS the rhetorical move
```
### Failure state as moral
```
Lose condition: Empire collapses if happiness < 50%
Encoded argument: "Subject welfare is instrumentally necessary, not intrinsically valued"
vs.
Lose condition: Game ends when one citizen dies
Encoded argument: "Each person has infinite worth"
```
### Reward loop as ethics
```
Reward: +XP per enemy killed
Argument (unintended): violence is the path to progress
Reward: +XP per peaceful resolution
Argument: dialogue valued
→ Designers encode ethics whether they intend to or not
```
### Counter-rhetoric (anti-game)
```
Players expect: shooter rewards aggression
Anti-game: every kill ages your character +1 year, game ends at 100
→ Mechanic refutes the genre's implicit argument
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Educational claim | Simulate causal model, let player explore |
| Empathy goal | Constrain player to NPC perspective |
| Critique of system | Make player IS the system, feel its pressures |
| Information delivery | Verbal/visual still better for facts |
| Complex policy | Procedural model + verbal scaffolding |
**기본값**: identify the felt experience the player should have, design mechanics that produce it, then verify via playtest.
## 🔗 Graph
- 부모: [[Game-Design]]
- 변형: [[Persuasive-Games]]
- 응용: [[Beat Saber 엑서게임 연구(Beat Saber Exergaming Study)]] · [[Edtech-Industry-Trends]]
- Adjacent: [[Media-Literacy]] · [[Information-Society]]
## 🤖 LLM 활용
**언제**: analyze a game's procedural argument, brainstorm mechanics that embody a thesis, generate playtest probes.
**언제 X**: never collapse procedural rhetoric to "narrative" — the rules ARE the argument.
## ❌ 안티패턴
- **Skin over substance**: stick a "climate change" theme on standard mechanics — argument absent.
- **Sermon mechanic**: the only "right" choice — no agency, weak rhetoric.
- **Unintended argument**: reward loop says A while writing says B — players believe the loop.
- **Realism worship**: simulation accuracy ≠ rhetorical clarity.
## 🧪 검증 / 중복
- Verified (Bogost *Persuasive Games* 2007, *How to Do Things with Videogames* 2011, Frasca *Videogames of the Oppressed*).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Bogost framework + 2026 LLM-NPC angle |
@@ -0,0 +1,199 @@
---
id: wiki-2026-0508-quality-control
title: Quality Control
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [QC, Software Quality]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [quality, testing, process]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript/Python
framework: Playwright/pytest
---
# Quality Control
## 매 한 줄
> **"매 quality 의 inspect 보다 build-in"**. 매 modern QC 의 shift-left — 매 unit test, type checking, static analysis, contract test, e2e — 매 layer 의 different bug class catch. 2026 의 LLM-augmented test generation + property-based testing 의 mainstream.
## 매 핵심
### 매 Test pyramid (2026 update)
- **Unit (60-70%)**: pure function, fast, isolated.
- **Integration (15-25%)**: module + DB/queue, real dependencies via testcontainers.
- **E2E (5-10%)**: full user journey, Playwright/Cypress.
- **Contract (5%)**: Pact, consumer-driven, prevent break-on-deploy.
- **Property-based (cross-cutting)**: Hypothesis/fast-check, find edge cases.
### 매 Quality gates
- 매 PR 의 merge 전: lint, type, unit test, coverage threshold, security scan.
- 매 deploy 전: integration test, smoke test, canary metrics.
- 매 prod: synthetic monitoring, real-user monitoring (RUM).
### 매 Defect classes
- **Functional**: wrong output for given input.
- **Performance**: slow, regression on benchmark.
- **Security**: OWASP categories.
- **Accessibility**: WCAG violations.
- **Compatibility**: browser/OS specific.
### 매 응용
1. CI/CD pipeline gates.
2. Pre-merge bots (Danger, Reviewdog).
3. Mutation testing (Stryker) — quality of tests themselves.
4. Visual regression (Chromatic, Percy).
5. Chaos engineering (production resilience).
## 💻 패턴
### Property-based testing (TypeScript with fast-check)
```typescript
import fc from 'fast-check';
import { reverse } from './lib';
test('reverse twice = identity', () => {
fc.assert(
fc.property(fc.array(fc.integer()), (arr) => {
expect(reverse(reverse(arr))).toEqual(arr);
}),
);
});
```
### Contract test (Pact)
```typescript
// Consumer side
const provider = new Pact({ consumer: 'Web', provider: 'OrdersAPI' });
await provider.addInteraction({
state: 'order 123 exists',
uponReceiving: 'a request for order 123',
withRequest: { method: 'GET', path: '/orders/123' },
willRespondWith: {
status: 200,
body: { id: '123', total: 99.0 },
},
});
// Generates pact.json — provider verifies against it in CI
```
### Mutation testing (Stryker)
```javascript
// stryker.conf.js
export default {
testRunner: 'vitest',
mutate: ['src/**/*.ts'],
thresholds: { high: 80, low: 60, break: 50 },
};
// Mutates code (a + b → a - b) and checks if tests catch it
// Surviving mutants = weak tests
```
### LLM-assisted test generation (2026 pattern)
```typescript
// CI step: claude-code generates edge cases
// $ claude test-gen src/parser.ts --output tests/parser.gen.test.ts
// Then human review before merge — never blind-trust
```
### Visual regression (Playwright)
```typescript
test('homepage matches snapshot', async ({ page }) => {
await page.goto('/');
await page.waitForLoadState('networkidle');
expect(await page.screenshot()).toMatchSnapshot('home.png', {
maxDiffPixelRatio: 0.01,
});
});
```
### Coverage gates (vitest)
```typescript
// vitest.config.ts
export default {
test: {
coverage: {
provider: 'v8',
thresholds: {
lines: 80,
functions: 80,
branches: 75,
statements: 80,
},
},
},
};
```
### Pre-commit hook (lint-staged + husky)
```json
{
"lint-staged": {
"*.{ts,tsx}": [
"eslint --fix",
"prettier --write",
"vitest related --run"
]
}
}
```
### Chaos test (Toxiproxy / Litmus)
```yaml
# Inject 500ms latency into Redis dependency
apiVersion: chaos-mesh.org/v1alpha1
kind: NetworkChaos
spec:
action: delay
selector:
labelSelectors: { app: redis }
delay: { latency: 500ms }
duration: 60s
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Pure logic | Unit + property-based |
| Multi-service flow | Integration + contract |
| User journey | E2E (sparingly) |
| Performance regression | Benchmark in CI |
| Visual UI | Snapshot + Chromatic |
| Test confidence | Mutation score |
**기본값**: 80% line coverage, mutation score >70%, property-based for parsers/serializers.
## 🔗 Graph
- 부모: [[Test_Automation]]
- 변형: [[CI_CD_Pipeline]] · [[Test_Automation|Test_Automation_Mastery]]
- 응용: [[Engineering Metrics (DORA)]] · [[Automated Quality & Review]]
- Adjacent: [[Continuous Integration (CI)|Continuous_Integration]] · [[Husky]]
## 🤖 LLM 활용
**언제**: generate edge cases, suggest mutation-resistant assertions, identify untested branches.
**언제 X**: never let LLM write the assertion AND implementation — confirmation bias.
## ❌ 안티패턴
- **Coverage worship**: 100% coverage, 0% assertions ("test executes but checks nothing").
- **Flaky tests ignored**: erodes trust in suite. Quarantine and fix immediately.
- **E2E-heavy pyramid**: slow, flaky, expensive. Push down to integration/unit.
- **Manual QA only**: doesn't scale, regression-prone.
- **No mutation testing**: blind to assertion quality.
## 🧪 검증 / 중복
- Verified (Google Testing Blog, Mike Cohn pyramid, Stryker docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — pyramid + 2026 LLM-assisted patterns |
@@ -0,0 +1,196 @@
---
id: wiki-2026-0508-raycasting
title: Raycasting
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [ray casting, ray-object intersection, picking, ray-sphere, ray-triangle]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [graphics, geometry, ray-tracing, picking, collision]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript/GLSL
framework: Three.js, WebGPU, three-mesh-bvh
---
# Raycasting
## 매 한 줄
> **"매 ray 와 매 geometry 의 intersection test"**. 매 1968 Arthur Appel 의 매 first hidden surface paper 매 origin, 매 1992 Wolfenstein 3D 의 매 game engine signature. 매 2026 의 매 universal primitive: mouse picking, hit-test, AR placement, lighting, AI vision-cone, BIM section. 매 Raycasting ≠ Ray Tracing — 매 single ray (no recursion) vs 매 recursive light path.
## 매 핵심
### 매 raycasting vs raytracing
| | Raycasting | Ray Tracing |
|---|---|---|
| Recursion | 매 single hit | 매 reflection / refraction recursive |
| Cost | 매 O(log N) per ray (BVH) | 매 50-1000x heavier |
| Use | Picking, collision | Photorealistic render |
### 매 Ray = origin + t·direction
- t > 0: 매 forward.
- nearest hit: 매 minimum t > 0.
- ray vs primitive: 매 sphere / plane / triangle / AABB / OBB.
### 매 acceleration structure
- BVH (Bounding Volume Hierarchy): 매 dominant 매 2026.
- KD-tree: 매 static scene 매 slightly faster build.
- Octree: 매 voxel world.
- Spatial hash: 매 dynamic scene.
### 매 응용
1. Mouse picking (Three.js Raycaster).
2. AR object placement (hit-test with depth).
3. AI line-of-sight / vision cone.
4. Bullet physics (sweep test).
5. Audio occlusion (raycast for muffle).
6. BIM 의 section plane / clipper.
## 💻 패턴
### 1. Three.js mouse picking
```ts
import * as THREE from 'three';
const raycaster = new THREE.Raycaster();
const mouse = new THREE.Vector2();
window.addEventListener('pointerdown', (e) => {
mouse.x = (e.clientX / innerWidth) * 2 - 1;
mouse.y = -(e.clientY / innerHeight) * 2 + 1;
raycaster.setFromCamera(mouse, camera);
const hits = raycaster.intersectObjects(scene.children, true);
if (hits.length) console.log('Hit:', hits[0].object.name, hits[0].point);
});
```
### 2. Ray-sphere intersection (analytic)
```ts
function raySphere(ro: V3, rd: V3, center: V3, r: number): number {
const oc = sub(ro, center);
const b = dot(oc, rd);
const c = dot(oc, oc) - r * r;
const h = b * b - c;
if (h < 0) return -1;
const t = -b - Math.sqrt(h);
return t >= 0 ? t : -1;
}
```
### 3. Ray-triangle (Möller-Trumbore)
```ts
function rayTriangle(ro: V3, rd: V3, a: V3, b: V3, c: V3): number {
const e1 = sub(b, a), e2 = sub(c, a);
const p = cross(rd, e2);
const det = dot(e1, p);
if (Math.abs(det) < 1e-8) return -1;
const inv = 1 / det;
const tv = sub(ro, a);
const u = dot(tv, p) * inv;
if (u < 0 || u > 1) return -1;
const q = cross(tv, e1);
const v = dot(rd, q) * inv;
if (v < 0 || u + v > 1) return -1;
return dot(e2, q) * inv;
}
```
### 4. BVH-accelerated picking (three-mesh-bvh)
```ts
import { computeBoundsTree, acceleratedRaycast } from 'three-mesh-bvh';
THREE.BufferGeometry.prototype.computeBoundsTree = computeBoundsTree;
THREE.Mesh.prototype.raycast = acceleratedRaycast;
mesh.geometry.computeBoundsTree(); // 매 once
// 매 매 raycast 100x+ faster
```
### 5. AR hit-test (WebXR)
```ts
const session = await navigator.xr.requestSession('immersive-ar', {
requiredFeatures: ['hit-test']
});
const refSpace = await session.requestReferenceSpace('viewer');
const hitSource = await session.requestHitTestSource({ space: refSpace });
session.requestAnimationFrame(function frame(t, frame) {
const results = frame.getHitTestResults(hitSource);
if (results.length) {
const pose = results[0].getPose(refSpace);
placeReticleAt(pose.transform.matrix);
}
session.requestAnimationFrame(frame);
});
```
### 6. Vision cone (AI agent)
```ts
function canSee(agent: Agent, target: V3, world: BVH): boolean {
const dir = normalize(sub(target, agent.pos));
const angle = Math.acos(dot(dir, agent.forward));
if (angle > agent.fov / 2) return false;
const dist = length(sub(target, agent.pos));
if (dist > agent.sightRange) return false;
const hit = world.raycastFirst(agent.pos, dir);
return !hit || hit.t >= dist - 0.01;
}
```
### 7. WebGPU compute-shader raycast
```wgsl
@compute @workgroup_size(64)
fn cs_raycast(@builtin(global_invocation_id) id: vec3u) {
let ray = rays[id.x];
var t_min = 1e30;
var hit_idx = -1;
for (var i = 0u; i < tri_count; i++) {
let t = ray_triangle(ray, tris[i]);
if (t > 0.0 && t < t_min) { t_min = t; hit_idx = i32(i); }
}
results[id.x] = Hit(t_min, hit_idx);
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| < 1k triangles | Naive Three.js raycaster 충분 |
| 1k-100k triangles | three-mesh-bvh (BVH on CPU) |
| 100k-10M, dynamic | refit BVH per frame + worker |
| 10M+ static | WebGPU compute + GPU BVH |
| Voxel world (Minecraft-ish) | DDA / Amanatides-Woo (매 grid traversal) |
| AR placement | WebXR hit-test API (매 system-provided) |
**기본값**: Three.js + three-mesh-bvh 매 web 의 standard. 매 dynamic 매 BVH refit. 매 GPU compute 매 last resort.
## 🔗 Graph
- 부모: [[Computational Geometry]] · [[Computer Graphics]]
- 응용: [[Collision Detection]]
- Adjacent: [[KD-Tree]]
## 🤖 LLM 활용
**언제**: 매 3D scene 매 user input mapping (click/touch/AR). 매 line-of-sight / occlusion query. 매 sweep collision 1-shot.
**언제 X**: 매 2D UI hit-test (DOM event 매 충분). 매 dense per-pixel intersection — 매 GPU rasterization 매 더 fast.
## ❌ 안티패턴
- **매 frame 의 brute-force intersect 모든 triangle**: 매 100k tri scene 매 60fps 의 X — 매 BVH 필수.
- **BVH refit 의 X 매 dynamic mesh**: 매 stale tree → 매 missed hits.
- **Far plane 무시**: 매 무한 ray 매 매 distant unimportant geom hit.
- **Ray direction 매 unnormalized**: 매 t value 매 distance 의 X — 매 모든 distance compare 매 broken.
- **Single-precision float 의 self-intersection**: 매 origin offset (`+ 0.001 * normal`) 매 epsilon 처리.
## 🧪 검증 / 중복
- Verified (Möller-Trumbore 1997 paper, Three.js 2026 source, three-mesh-bvh 0.7+).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Möller-Trumbore + BVH + WebXR hit-test + WebGPU compute |
@@ -0,0 +1,167 @@
---
id: wiki-2026-0508-remote-rehabilitation
title: Remote Rehabilitation
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [telerehabilitation, telerehab, digital rehabilitation]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [rehabilitation, telehealth, devops, monitoring, healthtech]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: nextjs-supabase-webrtc
---
# Remote Rehabilitation
## 매 한 줄
> **"매 clinic 의 walls 의 dissolving — 매 patient 의 home 의 becoming 의 PT studio"**. Remote rehabilitation (telerehab) 의 PT/OT/cognitive therapy 의 delivering 의 video, sensors, gamified exercises 의 via. 2026 의 standard care 의 stroke recovery, post-op orthopedics, chronic pain — 매 reimbursement (CPT 98975-98981) 의 mainstream 의 making.
## 매 핵심
### 매 modalities
- **Synchronous**: 매 live video PT session — 매 therapist 의 form correction 의 real-time.
- **Asynchronous**: 매 patient 의 records exercise 의 video 의, 매 therapist 의 reviews 의 later.
- **RPM (Remote Patient Monitoring)**: 매 wearables 의 ROM, gait, HR 의 streaming 의 dashboard 의.
- **DTx (Digital Therapeutics)**: 매 prescription apps — 매 Akili EndeavorRx, 매 Pear reSET (deprecated).
### 매 tech stack 의 typical
- **Video**: WebRTC (Daily, Twilio Video, Zoom SDK) — 매 HIPAA BAA 의 require.
- **Pose estimation**: MediaPipe Pose, 매 Apple Vision Pro Body Tracking, 매 Google ML Kit.
- **Wearables**: Apple Watch, Whoop, IMU patches (BioStamp).
- **Backend**: FHIR R5 의 EHR integration 의, 매 HL7 Bulk Data API.
### 매 응용
1. 매 stroke recovery — 매 mirror therapy 의 VR 의.
2. 매 post-ACL 의 ROM tracking 의 IMU 의.
3. 매 chronic low back pain 의 Hinge Health-style 의 daily exercises.
## 💻 패턴
### Pose-based form scoring (MediaPipe + TS)
```typescript
import { PoseLandmarker, FilesetResolver } from '@mediapipe/tasks-vision';
const vision = await FilesetResolver.forVisionTasks(
'https://cdn.jsdelivr.net/npm/@mediapipe/tasks-vision@0.10/wasm'
);
const pose = await PoseLandmarker.createFromOptions(vision, {
baseOptions: { modelAssetPath: '/pose_landmarker_full.task' },
runningMode: 'VIDEO',
numPoses: 1,
});
function squatDepthScore(landmarks: any[]): number {
const hip = landmarks[24], knee = landmarks[26], ankle = landmarks[28];
const angle = Math.atan2(hip.y - knee.y, hip.x - knee.x) -
Math.atan2(ankle.y - knee.y, ankle.x - knee.x);
const deg = Math.abs((angle * 180) / Math.PI);
return deg < 90 ? 1.0 : Math.max(0, 1 - (deg - 90) / 30);
}
```
### WebRTC 의 HIPAA-compliant session 의
```typescript
import Daily from '@daily-co/daily-js';
const call = Daily.createCallObject({
audioSource: true,
videoSource: true,
dailyConfig: { useDevicePreferenceCookies: true },
});
await call.join({
url: signedRoomUrl, // server-issued, BAA-covered
token: patientJWT,
});
call.on('recording-started', (e) => logToFHIR(e.recordingId, encounterId));
```
### IMU streaming 의 ROM tracking
```typescript
const device = await navigator.bluetooth.requestDevice({
filters: [{ services: ['battery_service', 'heart_rate'] }],
optionalServices: ['0000fff0-0000-1000-8000-00805f9b34fb'],
});
const server = await device.gatt!.connect();
const svc = await server.getPrimaryService('0000fff0-0000-1000-8000-00805f9b34fb');
const ch = await svc.getCharacteristic('0000fff1-0000-1000-8000-00805f9b34fb');
await ch.startNotifications();
ch.addEventListener('characteristicvaluechanged', (e: any) => {
const dv = e.target.value as DataView;
const quat = [dv.getFloat32(0), dv.getFloat32(4), dv.getFloat32(8), dv.getFloat32(12)];
pushROM(quaternionToEulerDeg(quat));
});
```
### FHIR Observation 의 exercise log
```typescript
const obs = {
resourceType: 'Observation',
status: 'final',
category: [{ coding: [{ system: 'http://terminology.hl7.org/CodeSystem/observation-category', code: 'activity' }] }],
code: { coding: [{ system: 'http://loinc.org', code: '82290-8', display: 'ROM knee flexion' }] },
subject: { reference: `Patient/${patientId}` },
effectiveDateTime: new Date().toISOString(),
valueQuantity: { value: maxFlexionDeg, unit: 'deg', system: 'http://unitsofmeasure.org' },
};
await fetch(`${FHIR_BASE}/Observation`, { method: 'POST', headers, body: JSON.stringify(obs) });
```
### Adherence nudging (server cron)
```typescript
export default async (req: Request) => {
const { data: due } = await sb
.from('patients')
.select('id, phone, plan_id')
.lt('last_session_at', new Date(Date.now() - 86400_000).toISOString());
await Promise.all(
due!.map((p) => twilio.messages.create({
to: p.phone,
from: TWILIO_FROM,
body: '오늘 의 5분 의 PT routine 의 done?',
}))
);
return new Response('ok');
};
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| post-acute stroke | hybrid (sync video 2x/wk + async daily) |
| chronic pain (>3mo) | async-first DTx (Hinge, Sword) |
| post-op week 1-2 | sync-heavy + RPM continuous |
| medicare reimbursement 의 target | RTM/RPM (CPT 98975-77 + 98980-81) |
**기본값**: hybrid sync+async + IMU/wearable RPM, FHIR-backed.
## 🔗 Graph
- 변형: [[Pose Estimation]]
- 응용: [[Stroke Recovery]]
- Adjacent: [[WebRTC]]
## 🤖 LLM 활용
**언제**: exercise plan generation, session note summarization, patient-facing Q&A (with guardrails).
**언제 X**: clinical diagnosis, dosage decisions, medical advice 의 unsupervised 의.
## ❌ 안티패턴
- **Consumer Zoom 사용**: BAA 없음 — HIPAA violation.
- **PHI 의 client-side log**: console.log 의 patient name — 매 audit fail.
- **Pose model 의 cloud-only**: latency >200ms — 매 form correction 의 useless.
- **Adherence ignore**: 매 70%+ patients drop off by week 3 — nudging 없으면 ROI zero.
## 🧪 검증 / 중복
- Verified (CMS RTM/RPM 2025 final rule, Hinge Health 의 BMJ 2024 RCT, MediaPipe Pose docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — telerehab tech stack + FHIR/WebRTC/pose patterns |
@@ -0,0 +1,146 @@
---
id: wiki-2026-0508-sast
title: SAST
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Static Application Security Testing, static analysis, source code analysis]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [security, sast, devsecops, static-analysis, ci-cd]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: multi
framework: semgrep-codeql-snyk
---
# SAST
## 매 한 줄
> **"매 source 의 reading 없이 의 running"**. SAST (Static Application Security Testing) 의 source code, bytecode, binary 의 의 inspecting 의 vulnerabilities 의 detecting 의 — 매 runtime 의 없이. 2026 의 dominant tools: Semgrep (rule-based, fast), CodeQL (semantic, deep), Snyk Code (DeepCode AI).
## 매 핵심
### 매 SAST 의 기본 mechanics
- **AST/CFG/DFG**: source 의 parse → AST → control-flow graph → data-flow graph.
- **Taint analysis**: 매 source (user input) → sink (sql query) 의 path 의 trace.
- **Pattern matching**: 매 known anti-pattern (e.g., `eval(req.body)`) 의 detect.
- **Symbolic execution** (heavy): 매 path constraints 의 SMT solver 의 — 매 CodeQL.
### 매 modern tools 의 비교
- **Semgrep** (2026): YAML rules, 매 fast (CI-friendly), 매 OSS + Pro (Semgrep Code).
- **CodeQL** (GitHub): semantic queries, 매 deep — 매 GitHub Advanced Security 에 free for OSS.
- **Snyk Code**: AI-augmented (DeepCode), 매 fast, 매 commercial.
- **SonarQube**: code quality + security 의 hybrid.
### 매 응용
1. PR-blocking gate (block-on-high).
2. Pre-commit (fast subset).
3. Nightly full scan + Jira issue 의 auto-create.
## 💻 패턴
### Semgrep custom rule (taint TS)
```yaml
rules:
- id: dangerous-eval-from-request
languages: [typescript, javascript]
severity: ERROR
message: 매 user input 의 eval 의 — RCE 위험
mode: taint
pattern-sources:
- pattern-either:
- pattern: req.body
- pattern: req.query
- pattern: req.params
pattern-sinks:
- pattern-either:
- pattern: eval(...)
- pattern: new Function(...)
```
### GitHub Actions — Semgrep CI
```yaml
name: SAST
on: [pull_request]
jobs:
semgrep:
runs-on: ubuntu-latest
container: returntocorp/semgrep
steps:
- uses: actions/checkout@v4
- run: semgrep ci --config=p/owasp-top-ten --config=.semgrep/
env:
SEMGREP_APP_TOKEN: ${{ secrets.SEMGREP_APP_TOKEN }}
```
### CodeQL query 의 hardcoded secret
```ql
import javascript
from StringLiteral s
where s.getValue().regexpMatch("AKIA[0-9A-Z]{16}")
select s, "매 hardcoded AWS key 의 detected"
```
### Pre-commit hook — fast subset
```bash
#!/usr/bin/env bash
changed=$(git diff --cached --name-only --diff-filter=ACMR | grep -E '\.(ts|tsx|js|py)$')
[ -z "$changed" ] && exit 0
echo "$changed" | xargs semgrep --config=p/security-audit --error
```
### SARIF upload 의 GitHub code scanning 의
```yaml
- run: semgrep ci --sarif --output=semgrep.sarif || true
- uses: github/codeql-action/upload-sarif@v3
with: { sarif_file: semgrep.sarif }
```
### Triage — false positive 의 suppress 의
```typescript
// nosemgrep: dangerous-eval-from-request
// 매 reason: input 의 zod-validated 의 already
const result = eval(safeMath); // ok
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| OSS project, 매 fast feedback | Semgrep (free OSS rules) |
| GitHub repo, 매 deep semantic | CodeQL (GHAS) |
| polyglot enterprise | Snyk Code or SonarQube |
| custom org rules 의 heavy | Semgrep Pro |
**기본값**: Semgrep (PR gate, p/owasp-top-ten) + CodeQL (nightly, scheduled).
## 🔗 Graph
- 부모: [[CI/CD Pipeline & IDE Security Integration|DevSecOps]] · [[Application Security]]
- 변형: [[보안 및 시스템 신뢰성 표준|DAST]] · [[IAST]] · [[SCA_Fundamentals|SCA]]
- 응용: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]] · [[Secure SDLC]]
- Adjacent: [[CodeQL]] · [[Semgrep]]
## 🤖 LLM 활용
**언제**: triaging findings, generating fix PRs (Copilot Autofix style), writing custom rules from natural language.
**언제 X**: trusting AI-only triage 없이 의 human review — 매 false positives 여전히 30-50%.
## ❌ 안티패턴
- **Block-on-everything**: medium severity 의 PR block — devs 의 SAST 의 disable 의.
- **No suppression hygiene**: `nosemgrep` 의 reason 없이 spammed.
- **Tool-only**: SAST 만 — DAST/SCA 없으면 runtime + dependency 의 blind.
- **Scan once a quarter**: 매 finding backlog 의 explode.
## 🧪 검증 / 중복
- Verified (Semgrep Registry 2026, GitHub CodeQL docs, OWASP SAST guide).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Semgrep/CodeQL 의 modern SAST patterns |
@@ -0,0 +1,155 @@
---
id: wiki-2026-0508-sre
title: SRE
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Site Reliability Engineering, production engineering]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [sre, reliability, slo, observability, devops]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: multi
framework: prometheus-grafana-opentelemetry
---
# SRE
## 매 한 줄
> **"매 reliability 의 feature 의 — 매 first feature 의"**. SRE (Site Reliability Engineering) 의 Google-originated discipline 의 software engineering 의 ops 의 applying. 핵심: SLOs 의 define, error budgets 의 enforce, toil 의 eliminate, blameless postmortems.
## 매 핵심
### 매 SRE 의 핵심 의 concepts
- **SLI**: 매 measurement (e.g., 200-OK rate over 5min).
- **SLO**: 매 target (e.g., 99.9% over 28d rolling).
- **SLA**: 매 customer contract (with $ penalty).
- **Error budget**: 매 100% - SLO. 매 budget 의 burn 시 release freeze.
### 매 four golden signals (Google)
- Latency, Traffic, Errors, Saturation.
### 매 응용
1. SLO-driven alerting (multi-window burn rate).
2. Toil budget (≤50% of SRE time).
3. Blameless postmortem culture.
## 💻 패턴
### Prometheus SLO recording rules
```yaml
groups:
- name: slo.rules
interval: 30s
rules:
- record: api:availability:ratio_rate5m
expr: |
sum(rate(http_requests_total{job="api",code!~"5.."}[5m]))
/ sum(rate(http_requests_total{job="api"}[5m]))
- record: api:availability:ratio_rate1h
expr: |
sum(rate(http_requests_total{job="api",code!~"5.."}[1h]))
/ sum(rate(http_requests_total{job="api"}[1h]))
```
### Multi-window multi-burn-rate alert
```yaml
- alert: ApiErrorBudgetFastBurn
expr: |
(1 - api:availability:ratio_rate5m) > (14.4 * 0.001)
and
(1 - api:availability:ratio_rate1h) > (14.4 * 0.001)
for: 2m
labels: { severity: page }
annotations:
summary: "Fast burn — 매 2% budget 의 1h 의 consume 의"
```
### OpenTelemetry instrumentation (Node)
```typescript
import { NodeSDK } from '@opentelemetry/sdk-node';
import { OTLPTraceExporter } from '@opentelemetry/exporter-trace-otlp-http';
import { getNodeAutoInstrumentations } from '@opentelemetry/auto-instrumentations-node';
new NodeSDK({
traceExporter: new OTLPTraceExporter({ url: process.env.OTEL_ENDPOINT }),
instrumentations: [getNodeAutoInstrumentations()],
}).start();
```
### Runbook automation (Python)
```python
import kubernetes.client as k8s
def remediate(pod_name: str, ns: str):
api = k8s.CoreV1Api()
api.delete_namespaced_pod(pod_name, ns)
notify_slack(f"매 auto-restart {ns}/{pod_name} (high mem)")
```
### Postmortem template
```markdown
# Incident YYYY-MM-DD: <title>
**Status**: resolved
**Impact**: <users affected, $ lost, duration>
**Severity**: SEV-2
## Timeline (UTC)
- 14:02 alert fired
- 14:05 oncall paged
- 14:18 root cause identified
- 14:31 mitigated
## Root Cause
<technical>
## Action Items
- [ ] (P0) Fix race in checkout-svc — owner: @x
- [ ] (P1) Add SLO alert for queue depth — owner: @y
```
### Toil tracking
```typescript
type Toil = { repetitive: boolean; manual: boolean; automatable: boolean; ts: Date };
// dashboard: toil hours / total hours per quarter, target ≤50%
```
## 매 결정 기준
| 상황 | SLO |
|---|---|
| user-facing read API | 99.9% availability, p99 <300ms |
| user-facing write API | 99.95% availability, p99 <500ms |
| internal batch | 99.5% job completion within window |
| free-tier feature | 99% (lower budget = ship faster) |
**기본값**: 99.9% availability, multi-burn-rate alerts, weekly error-budget review.
## 🔗 Graph
- 부모: [[DevOps]] · [[Production Engineering]]
- 변형: [[Platform Engineering]] · [[CI/CD Pipeline & IDE Security Integration|DevSecOps]]
- 응용: [[Observability]] · [[Chaos Engineering]]
- Adjacent: [[Prometheus]] · [[OpenTelemetry]]
## 🤖 LLM 활용
**언제**: postmortem drafting from timeline, log anomaly summarization, runbook generation, oncall question answering.
**언제 X**: auto-remediation 의 LLM-only — 매 hallucinated kubectl 의 prod 의 destroy.
## ❌ 안티패턴
- **No SLO**: 매 alert noise — 매 every blip 의 page.
- **100% uptime goal**: 매 unattainable, 매 budget 0 = no innovation.
- **Blame culture**: postmortem 의 finger-pointing — engineers 의 hide incidents.
- **Toil unbounded**: SREs 의 burned out — quit within 12mo.
## 🧪 검증 / 중복
- Verified (Google SRE Book, SRE Workbook, Prometheus docs, Sloth SLO generator).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — SLO + burn-rate + OTel patterns |
@@ -0,0 +1,149 @@
---
id: wiki-2026-0508-scavenge
title: Scavenge
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Minor GC, Scavenger, Young Generation GC, Cheney Scavenger]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [v8, garbage-collection, memory, runtime]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: cpp
framework: v8-orinoco
---
# Scavenge
## 매 한 줄
> **"매 young object 의 매 빠른 die — 매 cheap 하게 collect"**. Scavenge 는 매 generational hypothesis (most objects die young) 의 매 exploit — 매 V8 young generation 을 매 from-space / to-space 로 나누고 매 live object 만 매 to-space 로 매 copy. 매 dead object 는 매 단순 abandon. 2026 V8 (Orinoco) 에서 매 parallel + concurrent 로 매 main-thread pause < 1ms.
## 매 핵심
### 매 Cheney's algorithm
1. Allocate in to-space (linear bump pointer).
2. When full → 매 swap roles. From-space = 매 old to-space.
3. From roots, copy 매 reachable object to (new) to-space.
4. Update 매 forwarding pointer in from-space slot.
5. BFS through copied objects, copying 매 referenced objects.
6. Done → from-space 매 entirely abandoned.
### 매 V8-specific
- Young gen = New Space ≈ 1–8 MB per worker.
- Promotion: 매 survives 2 scavenges → 매 Old Space.
- Parallel Scavenge (2018+): 매 multiple threads.
- Concurrent (2021+): root marking on background.
### 매 응용
1. JS heap young gen.
2. Java HotSpot Young Generation (Parallel Scavenge collector).
3. .NET Gen 0/1.
4. Erlang per-process heap.
## 💻 패턴
### Cheney scavenge (pseudo-C)
```c
typedef struct { intptr_t header; void* slots[]; } Object;
char *from, *to, *alloc;
void* scavenge_copy(Object *obj) {
if (is_forwarded(obj)) return forwarded_addr(obj);
size_t size = obj_size(obj);
Object *copy = (Object*)alloc;
memcpy(copy, obj, size);
alloc += size;
set_forwarded(obj, copy);
return copy;
}
void scavenge() {
swap(&from, &to);
alloc = to;
char *scan = to;
for (Root *r = roots; r; r = r->next) *r = scavenge_copy(*r);
while (scan < alloc) {
Object *o = (Object*)scan;
for (int i = 0; i < slot_count(o); i++)
o->slots[i] = scavenge_copy(o->slots[i]);
scan += obj_size(o);
}
}
```
### Allocation (bump pointer)
```c
void* alloc_young(size_t bytes) {
if (alloc + bytes > to_end) trigger_scavenge();
void *p = alloc;
alloc += bytes;
return p;
}
```
### Promotion check
```c
if (obj_age(o) >= 2) {
void *promoted = alloc_old(obj_size(o));
memcpy(promoted, o, obj_size(o));
// also update remembered set if old → young pointers exist
} else {
scavenge_copy(o);
inc_age(o);
}
```
### Remembered set (write barrier)
```c
void store_field(Object *obj, int slot, Object *val) {
obj->slots[slot] = val;
if (in_old_space(obj) && in_young_space(val))
remembered_set_add(&obj->slots[slot]);
}
```
### V8 trace (observe scavenge)
```bash
node --trace-gc app.js
# [12345:0x...] 100 ms: Scavenge 5.5 (6.7) -> 4.8 (7.7) MB, 0.4 / 0.0 ms
```
## 매 결정 기준
| 상황 | Strategy |
|---|---|
| 매 short-lived alloc heavy | Larger young gen (--max-semi-space-size) |
| 매 long-lived heavy | Smaller young, faster promotion |
| 매 latency-critical | Concurrent scavenge enabled |
| 매 throughput | Parallel scavenge |
**기본값**: V8 default — auto-tuned per workload.
## 🔗 Graph
- 부모: [[Garbage Collection]] · [[V8 Engine]]
- 변형: [[Mark-Sweep-Compact]] · [[Major GC]]
- 응용: [[New Space(Young Generation)]] · [[Cheneys Algorithm]]
- Adjacent: [[Orinoco GC]] · [[Stop-the-world]]
## 🤖 LLM 활용
**언제**: GC log analysis, allocation hotspot identification from heap snapshots, write-barrier overhead estimation.
**언제 X**: 매 actual GC algorithm change — runtime team only.
## ❌ 안티패턴
- **Massive young alloc + immediate retain**: 매 promotion storm → 매 old space pressure.
- **Linked list of small objects**: 매 scan cost 의 매 linear in slots → 매 use TypedArray.
- **Disabling GC**: 매 --no-gc — 매 memory grows unbounded.
## 🧪 검증 / 중복
- Verified (V8 Orinoco docs, Cheney 1970 paper, "The Garbage Collection Handbook" 2nd Ed.).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — Cheney + V8 Orinoco parallel-concurrent state |
@@ -0,0 +1,168 @@
---
id: wiki-2026-0508-secret-management
title: Secret Management
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Secrets Management, Credential Management, Vault]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [security, devsecops, credentials, kms]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: multi
framework: vault-aws-kms
---
# Secret Management
## 매 한 줄
> **"매 secret 은 매 git 에 절대 — 매 vault 에"**. Secret management 는 매 API key, DB password, certificate, signing key 의 매 lifecycle (issue, store, rotate, revoke, audit) 의 매 centralized control. 2026 현재 매 HashiCorp Vault, AWS Secrets Manager, GCP Secret Manager, Doppler, Infisical 가 매 dominant; 매 SPIFFE/SPIRE workload identity, 매 short-lived (15min) tokens 가 매 long-lived API key 를 매 replace.
## 매 핵심
### 매 Anti-secrets
- Hardcoded in source.
- Plain in `.env` committed.
- Shared via Slack DM.
- Long-lived (years) static API keys.
### 매 Pillars
- **Encryption at rest**: KMS-backed.
- **Encryption in transit**: TLS-only.
- **Access control**: RBAC + audit log.
- **Rotation**: automated (DB pwd, KMS key).
- **Workload identity**: 매 service ≠ user — 매 ephemeral token 의 매 cloud IAM.
- **Detection**: 매 git pre-commit (gitleaks, trufflehog) + 매 GitHub secret scanning.
### 매 응용
1. App → DB: dynamic creds.
2. CI → cloud: OIDC federation, no static keys.
3. K8s pod → AWS: IRSA / Workload Identity.
4. Cross-service: SPIFFE SVID.
## 💻 패턴
### Vault dynamic DB cred
```bash
vault write database/roles/app-readonly \
db_name=postgres-prod \
creation_statements="CREATE ROLE \"{{name}}\" WITH LOGIN PASSWORD '{{password}}' VALID UNTIL '{{expiration}}'; GRANT SELECT ON ALL TABLES IN SCHEMA public TO \"{{name}}\";" \
default_ttl=1h max_ttl=24h
# App requests cred
vault read database/creds/app-readonly
# username: v-token-app-readonly-x9a..., password: A1b2C3..., lease_id: ..., lease_duration: 3600
```
### GitHub Actions OIDC → AWS (no static keys)
```yaml
permissions:
id-token: write
contents: read
jobs:
deploy:
runs-on: ubuntu-latest
steps:
- uses: aws-actions/configure-aws-credentials@v4
with:
role-to-assume: arn:aws:iam::123:role/github-deploy
aws-region: us-east-1
- run: aws s3 sync ./build s3://prod-bucket/
```
### Pre-commit secret scan
```yaml
# .pre-commit-config.yaml
repos:
- repo: https://github.com/gitleaks/gitleaks
rev: v8.18.0
hooks:
- id: gitleaks
```
### App-side fetch with caching
```typescript
import { SecretsManagerClient, GetSecretValueCommand } from "@aws-sdk/client-secrets-manager";
const sm = new SecretsManagerClient({});
const cache = new Map<string, { value: any; expires: number }>();
async function getSecret(name: string): Promise<any> {
const cached = cache.get(name);
if (cached && cached.expires > Date.now()) return cached.value;
const res = await sm.send(new GetSecretValueCommand({ SecretId: name }));
const value = JSON.parse(res.SecretString!);
cache.set(name, { value, expires: Date.now() + 5 * 60_000 });
return value;
}
```
### K8s External Secrets Operator
```yaml
apiVersion: external-secrets.io/v1beta1
kind: ExternalSecret
metadata: { name: db-creds }
spec:
refreshInterval: 1h
secretStoreRef: { name: vault-backend, kind: ClusterSecretStore }
target: { name: db-creds }
data:
- secretKey: password
remoteRef: { key: database/creds/app, property: password }
```
### Rotation Lambda
```typescript
export async function rotateApiKey(event) {
const step = event.Step;
if (step === "createSecret") {
const newKey = await crypto.randomUUID();
await sm.putSecretValue({ SecretId: event.SecretId, ClientRequestToken: event.ClientRequestToken, SecretString: newKey, VersionStages: ["AWSPENDING"] });
} else if (step === "setSecret") { /* configure target */ }
else if (step === "testSecret") { /* test */ }
else if (step === "finishSecret") {
await sm.updateSecretVersionStage({ SecretId: event.SecretId, VersionStage: "AWSCURRENT", MoveToVersionId: event.ClientRequestToken });
}
}
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| 매 multi-cloud, 매 self-host | HashiCorp Vault |
| 매 AWS-only | Secrets Manager + Parameter Store |
| 매 dev-friendly UX | Doppler / Infisical |
| 매 K8s | External Secrets Operator + cloud KMS |
| 매 workload-to-workload | SPIFFE/SPIRE |
**기본값**: Cloud-native (Secrets Manager) + OIDC for CI + ESO for K8s.
## 🔗 Graph
- 부모: [[DevSecOps_Framework]] · [[Application Security]]
- 변형: [[KMS]] · [[PKI]]
- 응용: [[CI_CD_Pipeline]] · [[보안 및 시스템 신뢰성 표준|Zero-Trust Architecture]]
- Adjacent: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]] · [[OAuth 2.0]]
## 🤖 LLM 활용
**언제**: Secret-scanner triage (매 actual secret vs 매 test fixture?), rotation runbook generation, IAM policy synthesis from natural-language requirement.
**언제 X**: 매 secret 자체를 매 LLM context 에 매 넣지 마. 매 leak risk.
## ❌ 안티패턴
- **`.env` in git**: 매 even private repo — 매 contributor leak.
- **Long-lived keys**: 매 5-year IAM access key — 매 incident blast-radius huge.
- **Shared service account**: 매 audit trail 의 매 useless.
- **Plain ENV var visible to all containers**: 매 sidecar / multi-tenant — 매 leak.
## 🧪 검증 / 중복
- Verified (NIST SP 800-57, OWASP ASVS V6, CIS Benchmarks).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — OIDC federation + workload identity 2026 |
@@ -0,0 +1,160 @@
---
id: wiki-2026-0508-session-lifecycle
title: Session Lifecycle
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Session Management, Session State, Login Session]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [security, web, authentication, session]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: nextjs-redis
---
# Session Lifecycle
## 매 한 줄
> **"매 user 의 매 authenticated state 의 매 birth → death"**. Session lifecycle 는 매 login 으로 매 시작, 매 idle/absolute timeout 또는 매 explicit logout 으로 매 끝. 2026 현재 매 stateless JWT 의 매 short-lived access token (15 min) + 매 stateful refresh token (rotating, server-revocable) 의 매 hybrid 가 매 dominant; 매 OWASP ASVS V3 가 매 baseline.
## 매 핵심
### 매 Phases
1. **Auth**: credential verify (password, MFA, passkey).
2. **Issue**: session token (cookie / JWT) + binding (UA, IP optional).
3. **Validate**: per-request check + refresh.
4. **Refresh**: rotation on each use.
5. **Terminate**: logout, idle (15-30min), absolute (12-24h), forced (admin, breach).
### 매 Token strategies
- **Stateful (DB session)**: server stores; revocable instantly; scale via Redis.
- **Stateless JWT**: signed token; revocation via short TTL or blocklist.
- **Hybrid**: short JWT access + opaque refresh in DB.
### 매 Cookie attributes
- `HttpOnly` — XSS protection.
- `Secure` — TLS only.
- `SameSite=Lax` (or Strict) — CSRF.
- `__Host-` prefix — domain lock.
- `Path=/` and reasonable `Max-Age`.
### 매 응용
1. Web SPA + cookie session.
2. Mobile app + refresh-token rotation.
3. SSO (SAML/OIDC) federated.
4. Service mesh (mTLS-based).
## 💻 패턴
### Cookie session (Express + Redis)
```typescript
import session from "express-session";
import RedisStore from "connect-redis";
app.use(session({
store: new RedisStore({ client: redis, prefix: "sess:" }),
secret: process.env.SESSION_SECRET!,
resave: false,
saveUninitialized: false,
cookie: {
httpOnly: true, secure: true, sameSite: "lax",
maxAge: 30 * 60_000, // idle timeout via touch
},
rolling: true,
}));
```
### JWT access + rotating refresh
```typescript
function issueTokens(userId: string) {
const access = jwt.sign({ sub: userId }, ACCESS_SECRET, { expiresIn: "15m" });
const refresh = crypto.randomUUID();
redis.set(`refresh:${refresh}`, userId, "EX", 60 * 60 * 24 * 14);
return { access, refresh };
}
async function rotate(oldRefresh: string) {
const userId = await redis.get(`refresh:${oldRefresh}`);
if (!userId) throw new Error("invalid");
await redis.del(`refresh:${oldRefresh}`); // single-use
return issueTokens(userId);
}
```
### Idle + absolute timeout
```typescript
type Session = { userId: string; createdAt: number; lastSeenAt: number };
const ABSOLUTE = 24 * 3600_000;
const IDLE = 30 * 60_000;
function valid(s: Session): boolean {
const now = Date.now();
return now - s.createdAt < ABSOLUTE && now - s.lastSeenAt < IDLE;
}
```
### Global logout (token version)
```typescript
// User table column: tokenVersion (incremented on logout-everywhere)
const access = jwt.sign({ sub: user.id, ver: user.tokenVersion }, SECRET);
// On verify
if (decoded.ver !== currentUser.tokenVersion) throw new Error("revoked");
```
### Session hijack defense (binding)
```typescript
function bindClaims(req: Request) {
return crypto.createHash("sha256")
.update(req.headers["user-agent"] + req.ip).digest("hex");
}
// On issue: store. On validate: compare. Mismatch → require re-auth.
```
### Concurrent session limit
```typescript
const sessions = await redis.smembers(`user_sessions:${userId}`);
if (sessions.length >= 5) {
const oldest = sessions[0];
await redis.del(`sess:${oldest}`);
await redis.srem(`user_sessions:${userId}`, oldest);
}
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 Web SPA, 매 same domain | Cookie + CSRF token |
| 매 mobile / cross-origin | JWT access + refresh in secure storage |
| 매 high-security (banking) | Short access (5m) + step-up auth |
| 매 SSO required | OIDC + IdP-managed session |
**기본값**: HttpOnly Secure SameSite=Lax cookie + Redis-backed session, 30m idle / 24h absolute.
## 🔗 Graph
- 부모: [[Application Security]]
- 변형: [[JWT]] · [[OAuth 2.0]]
- 응용: [[보안 및 시스템 신뢰성 표준|OWASP Top 10]] · [[보안 및 시스템 신뢰성 표준|Zero-Trust Architecture]]
## 🤖 LLM 활용
**언제**: Session anomaly detection (매 sudden geo / device shift), suspicious-activity summary for support.
**언제 X**: 매 token issuance / signing — 매 deterministic crypto only.
## ❌ 안티패턴
- **localStorage JWT**: 매 XSS → 매 token theft. 매 HttpOnly cookie.
- **No refresh rotation**: 매 leaked refresh = 매 forever access.
- **No absolute timeout**: 매 1년 session — 매 dormant account hijack.
- **Client-side only check**: 매 every request server-side.
## 🧪 검증 / 중복
- Verified (OWASP Session Management Cheat Sheet, ASVS V3, NIST SP 800-63B).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — JWT+refresh hybrid + passkey-era state |
@@ -0,0 +1,190 @@
---
id: wiki-2026-0508-single-page-applications-spa
title: Single Page Applications (SPA)
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [SPA, Single-Page App, Client-Side App]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [web, frontend, architecture, routing]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: React/Vue/SvelteKit
---
# Single Page Applications (SPA)
## 매 한 줄
> **"매 한 HTML 의 모든 view 의 client-side 의 render"**. SPA 매 initial load 후 server-fetch 의 X 의 navigation — 매 data-only API call. 2026 매 SPA-only 의 declining trend — 매 SSR/RSC hybrid (Next.js 15, Remix, Astro Islands) 의 mainstream.
## 매 핵심
### 매 핵심 Architecture
- 매 single `index.html` shell.
- 매 JS bundle 의 view rendering (React / Vue / Svelte).
- Client-side routing (History API).
- 매 API 의 JSON fetch — REST / GraphQL / tRPC.
### 매 Pros
- 매 fluid navigation — 매 page reload X.
- 매 rich interactivity.
- 매 backend / frontend 분리 — 매 separate deploy.
### 매 Cons
- Initial bundle size — 매 large.
- SEO 의 challenge — 매 crawler 의 JS execution 의존.
- TTI (Time to Interactive) 의 slow.
- 매 JS-disabled / network-fail 의 blank screen.
### 매 vs MPA / SSR / SSG
- MPA: server 의 매 page-by-page render.
- SSR: 매 first render 의 server, 매 hydrate 후 SPA-like.
- SSG: 매 build-time 의 pre-render — 매 static deploy.
- RSC (React Server Components): 매 server/client 의 component-level mix.
### 매 2026 trend
- 매 pure SPA 의 niche (admin panel, internal tool).
- Next.js / Remix / SvelteKit 의 hybrid 의 default.
- Astro Islands — 매 partial hydration.
- 매 streaming SSR + Suspense — 매 perceived perf 개선.
## 💻 패턴
### React Router v7 — 매 client-side routing
```tsx
import { createBrowserRouter, RouterProvider } from "react-router";
const router = createBrowserRouter([
{ path: "/", element: <Home /> },
{ path: "/posts/:id", element: <Post />, loader: postLoader },
{ path: "*", element: <NotFound /> },
]);
export default function App() {
return <RouterProvider router={router} />;
}
```
### History API — manual SPA navigation
```typescript
function navigate(url: string) {
history.pushState({}, "", url);
render(); // re-render based on location.pathname
}
window.addEventListener("popstate", render);
```
### Code splitting — 매 route-level lazy
```tsx
import { lazy, Suspense } from "react";
const Dashboard = lazy(() => import("./Dashboard"));
<Suspense fallback={<Spinner />}>
<Dashboard />
</Suspense>
```
### Data fetching — TanStack Query
```typescript
import { useQuery } from "@tanstack/react-query";
function Post({ id }: { id: string }) {
const { data, isLoading } = useQuery({
queryKey: ["post", id],
queryFn: () => fetch(`/api/posts/${id}`).then(r => r.json()),
staleTime: 60_000,
});
if (isLoading) return <Skeleton />;
return <Article {...data} />;
}
```
### Vite — SPA build
```typescript
// vite.config.ts
import { defineConfig } from "vite";
import react from "@vitejs/plugin-react";
export default defineConfig({
plugins: [react()],
build: {
rollupOptions: {
output: {
manualChunks: {
vendor: ["react", "react-dom"],
ui: ["@radix-ui/react-dialog"],
},
},
},
},
});
```
### SPA fallback — server config (nginx)
```nginx
location / {
try_files $uri $uri/ /index.html;
}
```
### Skeleton + optimistic UI
```tsx
const mutation = useMutation({
mutationFn: postComment,
onMutate: async (newComment) => {
await queryClient.cancelQueries({ queryKey: ["comments"] });
const prev = queryClient.getQueryData(["comments"]);
queryClient.setQueryData(["comments"], (old: any) => [...old, newComment]);
return { prev };
},
onError: (_, __, ctx) => queryClient.setQueryData(["comments"], ctx.prev),
});
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Public marketing site | SSG (Astro / Next static) — 매 SPA X. |
| Content blog | SSG / ISR. |
| SaaS dashboard (auth-walled) | SPA OK — 매 SEO 의 X 필요. |
| E-commerce | SSR/RSC — 매 SEO + perceived perf. |
| Internal admin tool | SPA — Vite + React Router. |
| Rich realtime app | SPA + WebSocket. |
**기본값**: 매 새 project 의 Next.js / Remix / SvelteKit (hybrid). 매 pure SPA 의 internal tool 만.
## 🔗 Graph
- 부모: [[Web Architecture]]
- 변형: [[MPA]] · [[SSR]] · [[SSG]] · [[Islands Architecture]]
- 응용: [[SvelteKit]]
- Adjacent: [[Code Splitting]] · [[Hydration]] · [[Service Worker]]
## 🤖 LLM 활용
**언제**: 매 auth-walled rich app — admin, dashboard, realtime collaborative tool.
**언제 X**: 매 SEO-critical / content-heavy site — 매 SSR/SSG 의 사용.
## ❌ 안티패턴
- **매 SEO-critical site 의 pure SPA**: 매 crawler 문제 → SSR/SSG.
- **매 huge initial bundle (no code-split)**: TTI 악화.
- **매 in-memory routing 의 history API X**: 매 back-button 의 X.
- **매 server fallback (try_files) 의 X**: 매 deep-link refresh 의 404.
- **매 every state 의 Redux**: 매 over-engineering — TanStack Query + local useState.
## 🧪 검증 / 중복
- Verified (MDN Web Docs, React Router v7 docs).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — SPA arch + 2026 hybrid trend 정리 |
@@ -0,0 +1,151 @@
---
id: wiki-2026-0508-skinnedmesh
title: SkinnedMesh
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-1189F7, Skinned Mesh, GPU Skinning]
duplicate_of: none
source_trust_level: A
confidence_score: 0.93
verification_status: applied
tags: [3d, graphics, animation, threejs, webgl]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: Three.js / WebGL2
---
# SkinnedMesh
## 매 한 줄
> **"매 mesh 의 vertex 가 매 bone weight 에 의해 deformed — single draw call 의 articulated character"**. 1990s SGI/PowerAnimator 의 skinning 매 origin → 2026 GPU compute shader 매 thousands-of-bones 매 real-time. Three.js `SkinnedMesh` 매 WebGPU compute path 매 standard.
## 매 핵심
### 매 구성 요소
- **Mesh geometry**: vertex position + skin index (4 bones/vertex 매 typical) + skin weight.
- **Skeleton**: bone hierarchy + bind matrix (rest pose inverse).
- **Bone matrices**: world-space transform 매 per-bone, GPU 의 uniform buffer / data texture 의 upload.
### 매 GPU pipeline
- Vertex shader 의 매 vertex 의 bone matrices 의 weighted blend 의 적용 → world-space pos.
- Linear Blend Skinning (LBS) 매 default — 매 fast, 매 candy-wrapper artifact 의 risk.
- Dual Quaternion Skinning (DQS) 매 alternative — 매 volume-preserving, 매 ~1.3x cost.
### 매 응용
1. Character animation (게임, AR/VR avatar).
2. Cloth/soft-body 의 partial rigging.
3. Procedural creature 의 spline-driven bones.
## 💻 패턴
### Three.js 매 SkinnedMesh 생성
```ts
import * as THREE from 'three';
const geometry = new THREE.CylinderGeometry(0.3, 0.3, 4, 8, 8);
// skinIndex / skinWeight buffer 의 attach
const skinIndices: number[] = [];
const skinWeights: number[] = [];
for (let i = 0; i < geometry.attributes.position.count; i++) {
const y = geometry.attributes.position.getY(i) + 2; // 0..4
const skinIndex = Math.floor(y);
const skinWeight = y - skinIndex;
skinIndices.push(skinIndex, skinIndex + 1, 0, 0);
skinWeights.push(1 - skinWeight, skinWeight, 0, 0);
}
geometry.setAttribute('skinIndex', new THREE.Uint16BufferAttribute(skinIndices, 4));
geometry.setAttribute('skinWeight', new THREE.Float32BufferAttribute(skinWeights, 4));
// Bone hierarchy
const bones: THREE.Bone[] = [];
for (let i = 0; i <= 4; i++) {
const b = new THREE.Bone();
b.position.y = i === 0 ? -2 : 1;
if (i > 0) bones[i - 1].add(b);
bones.push(b);
}
const skeleton = new THREE.Skeleton(bones);
const mesh = new THREE.SkinnedMesh(geometry, new THREE.MeshStandardMaterial({ skinning: true } as any));
mesh.add(bones[0]);
mesh.bind(skeleton);
```
### 매 GLTF asset 매 load
```ts
import { GLTFLoader } from 'three/examples/jsm/loaders/GLTFLoader.js';
const loader = new GLTFLoader();
const gltf = await loader.loadAsync('/models/character.glb');
const skinned = gltf.scene.getObjectByProperty('isSkinnedMesh', true) as THREE.SkinnedMesh;
const mixer = new THREE.AnimationMixer(skinned);
const action = mixer.clipAction(gltf.animations[0]);
action.play();
```
### 매 GPU instancing 매 SkinnedMesh — `BatchedMesh` + skeleton texture
```ts
// 2026 Three.js r170+ 의 InstancedSkinnedMesh
const inst = new THREE.InstancedSkinnedMesh(geometry, material, 1000);
inst.boundingSphere = new THREE.Sphere(new THREE.Vector3(), 5);
// 매 per-instance 의 별도 skeleton bone matrix texture 의 upload
```
### 매 LBS 매 vertex shader (GLSL)
```glsl
mat4 skinMatrix =
skinWeight.x * boneMatrix(skinIndex.x) +
skinWeight.y * boneMatrix(skinIndex.y) +
skinWeight.z * boneMatrix(skinIndex.z) +
skinWeight.w * boneMatrix(skinIndex.w);
vec4 skinned = skinMatrix * vec4(position, 1.0);
gl_Position = projectionMatrix * modelViewMatrix * skinned;
```
### 매 bone matrix 의 DataTexture 매 upload (large skeleton)
```ts
const boneTexture = new THREE.DataTexture(
new Float32Array(bones.length * 16),
bones.length * 4, 1, THREE.RGBAFormat, THREE.FloatType,
);
skeleton.boneTexture = boneTexture; // automatically updated
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Character < 256 bones, 단일 instance | uniform array bone matrices |
| Character ≥ 256 bones, 매 mobile 의 uniform limit 의 hit | `boneTexture` (DataTexture) |
| 매 large crowd (100+ chars) | `InstancedSkinnedMesh` + 매 per-instance skeleton texture |
| 매 volume-preserving 의 deformation 의 필요 | DQS or 매 corrective shape keys |
| 매 simple twist 매 only | Bend modifier or 매 spline-IK 의 fallback |
**기본값**: GLTF + Three.js `SkinnedMesh` + LBS + `boneTexture` 의 mobile path.
## 🔗 Graph
- 부모: [[Three.js]] · [[WebGL 20|WebGL2]]
- Adjacent: [[BufferGeometry]] · [[BatchedMesh 및 InstancedMesh 성능 벤치마크]]
## 🤖 LLM 활용
**언제**: GLTF rigged character 의 import, 매 bone weight 의 painting 의 review, 매 skinning artifact 의 debug.
**언제 X**: 매 static prop 의 transform — `Mesh` + matrix update 의 더 cheap.
## ❌ 안티패턴
- **매 vertex 별 매 8+ bone weight**: GPU 매 4-weight 의 standard. Excess bones 의 normalize + drop low-weight 의 필요.
- **매 frame 별 `skeleton.update()` 의 manual call**: Three.js 매 already 매 auto. Redundant 의 cost.
- **매 bone matrix 의 CPU-side recompute** 매 frame: bone hierarchy 의 dirty flag 의 활용.
- **`SkinnedMesh.clone()` 의 후 매 same skeleton 의 share**: 매 separate `Skeleton.clone()` 의 필요 — else 매 모든 instances 매 같은 pose.
## 🧪 검증 / 중복
- Verified (Three.js docs r170, Khronos glTF 2.0 spec, Real-Time Rendering 4e Ch.4).
- 신뢰도 A.
- 중복 risk: [[GPU Skinning]] (alias).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — SkinnedMesh의 components, GPU pipeline, instancing 정리 |
@@ -0,0 +1,150 @@
---
id: wiki-2026-0508-solitude-optimization
title: Solitude Optimization
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [single-tenant optimization, dedicated-instance tuning, isolation tuning]
duplicate_of: none
source_trust_level: B
confidence_score: 0.75
verification_status: applied
tags: [performance, isolation, multi-tenant, devops, optimization]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: multi
framework: kubernetes-firecracker-cgroups
---
# Solitude Optimization
## 매 한 줄
> **"매 noisy neighbor 의 quiet 의 making"**. Solitude optimization 의 single-tenant / dedicated-isolation workloads 의 의 performance / cost 의 tuning 의 — 매 multi-tenant 의 sharing economy 의 step away. 2026 의 use-cases: HIPAA/SOC2 silo tenants, ML training pods, latency-critical RTC.
## 매 핵심
### 매 isolation 의 levels
- **Process** (cgroups, Linux namespaces): 매 weak.
- **VM** (KVM, Firecracker microVM): 매 strong, 매 ms-boot.
- **Bare metal**: 매 strongest, 매 slowest provisioning.
- **Confidential computing** (SEV-SNP, TDX): 매 memory encryption, 매 even cloud admin 못 read.
### 매 cost 의 vs noise tradeoff
- pool: 매 cheapest, 매 noisy.
- silo VM: 매 2-5x cost, 매 quiet + auditable.
- bare metal: 매 5-10x, 매 silent + compliance-friendly.
### 매 응용
1. Top-N enterprise tenants 의 dedicated DB instance.
2. ML training 의 dedicated GPU node (no neighbor jitter).
3. Real-time audio/video 의 dedicated compute pool.
## 💻 패턴
### Kubernetes node 의 dedicated taint
```yaml
kubectl label node gpu-node-1 tenant=acme dedicated=true
kubectl taint nodes gpu-node-1 dedicated=acme:NoSchedule
# pod spec
spec:
nodeSelector: { tenant: acme }
tolerations:
- key: dedicated
operator: Equal
value: acme
effect: NoSchedule
```
### CPU pinning + isolated cores
```yaml
# kubelet --reserved-cpus=0-1, --cpu-manager-policy=static
spec:
containers:
- name: rtc
resources:
requests: { cpu: "4", memory: "8Gi" }
limits: { cpu: "4", memory: "8Gi" }
```
### Firecracker microVM (per-tenant)
```bash
firectl --kernel ./vmlinux --root-drive ./tenant-rootfs.ext4 \
--cpu-template T2 --vcpu-count 2 --memory 1024 \
--tap-device tap-acme/AA:FC:00:00:00:01
```
### Postgres 의 logical replica 의 silo upgrade
```sql
CREATE PUBLICATION acme_pub FOR TABLE invoices, users WHERE (tenant_id='acme-uuid');
-- on dedicated instance:
CREATE SUBSCRIPTION acme_sub CONNECTION '...' PUBLICATION acme_pub;
```
### Redis — dedicated DB index per VIP tenant
```typescript
const dbIdx = tenant.tier === 'enterprise' ? tenantToDb[tenant.id] : 0;
const r = new Redis({ host, port, db: dbIdx });
```
### Network egress 의 per-tenant bandwidth shape (tc)
```bash
tc qdisc add dev eth0 root handle 1: htb default 30
tc class add dev eth0 parent 1: classid 1:1 htb rate 100mbit
tc filter add dev eth0 protocol ip parent 1:0 prio 1 \
u32 match ip src 10.244.5.7/32 flowid 1:1
```
### NUMA-aware 의 ML pod
```yaml
apiVersion: v1
kind: Pod
spec:
containers:
- name: trainer
resources:
requests:
cpu: "16"
memory: "64Gi"
nvidia.com/gpu: "1"
limits:
cpu: "16"
memory: "64Gi"
nvidia.com/gpu: "1"
```
## 매 결정 기준
| 상황 | Isolation |
|---|---|
| HIPAA enterprise customer | silo (dedicated DB + node taint) |
| ML training, p99 jitter < 5ms | dedicated GPU node + CPU pin |
| RTC audio/video VIPs | dedicated pool, NUMA-pinned |
| free-tier | pool (cgroups only) |
**기본값**: pool with QoS-Guaranteed for paid tiers, silo upgrade option for enterprise SLA.
## 🔗 Graph
- 응용: [[Firecracker]]
- Adjacent: [[SaaS]] · [[SLO]]
## 🤖 LLM 활용
**언제**: tier-tradeoff explanation to sales, capacity planning, generating taint/toleration manifests.
**언제 X**: auto-migrating tenants pool→silo 의 unchecked — 매 cutover 의 careful orchestration 필요.
## ❌ 안티패턴
- **Silo by default**: 매 cost balloon — pool 의 enough for 95% tenants.
- **No QoS class**: BestEffort pods 의 prod 의 — 매 OOMKill victims.
- **Dedicated 의 sold w/o SLO uplift**: 매 customer 의 perceived value 0.
- **Forget the data plane**: CPU silo 의 했지만 shared NIC/Disk — 매 noise 여전.
## 🧪 검증 / 중복
- Verified (Kubernetes CPU Manager, Firecracker docs, AWS Nitro/SEV-SNP, Postgres logical rep).
- 신뢰도 B (term "solitude optimization" 의 niche; 매 industry 표준 용어 의 multi-tenancy isolation tuning).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — isolation/silo patterns + microVM + NUMA |
@@ -0,0 +1,147 @@
---
id: wiki-2026-0508-source-control
title: Source Control
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [version control, VCS, git workflow]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [git, version-control, devops, workflow, collaboration]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: shell
framework: git-github-jujutsu
---
# Source Control
## 매 한 줄
> **"매 commit 의 atomic unit of intent"**. Source control (VCS) 의 code changes 의 의 history 의 record 의, 매 collaboration / rollback / branching 의 의 enable 의. 2026 의 dominant 의 git, 매 emerging: Jujutsu (jj) 의 ergonomic next-gen, 매 Sapling (Meta).
## 매 핵심
### 매 git 의 mental model
- **Snapshot**, not diffs. 매 commit 의 tree (file content hashes) 의 reference.
- **Three trees**: working dir, index (stage), HEAD.
- **Refs**: branches, tags, HEAD 의 commit pointers.
- **Object store**: blobs, trees, commits, tags — content-addressed (SHA-1/SHA-256).
### 매 modern workflows
- **Trunk-based**: short-lived branches (<24h), main 의 always deployable.
- **GitHub Flow**: feature branch → PR → merge to main.
- **GitFlow** (legacy): heavy 의 develop/release/hotfix branches — 매 2026 의 거의 not 추천.
### 매 응용
1. Trunk-based + feature flags (modern PLG SaaS).
2. Stacked PRs (Graphite, Sapling) for big changes.
3. Monorepo (Nx, Turborepo, Bazel).
## 💻 패턴
### Conventional commits + commitlint
```js
module.exports = {
extends: ['@commitlint/config-conventional'],
rules: {
'type-enum': [2, 'always', ['feat','fix','chore','docs','refactor','test','perf','build','ci']],
'scope-empty': [2, 'never'],
'subject-max-length': [2, 'always', 72],
},
};
```
### Pre-push hook (husky)
```bash
#!/usr/bin/env bash
. "$(dirname -- "$0")/_/husky.sh"
pnpm test --run && pnpm lint
```
### Squash-merge default + linear history
```bash
gh repo edit OWNER/REPO \
--enable-squash-merge --enable-rebase-merge=false --enable-merge-commit=false \
--delete-branch-on-merge
```
### Stacked PRs (Graphite)
```bash
gt branch create feat-foundation
gt branch create feat-api
gt submit --stack
```
### Bisect 매 regression
```bash
git bisect start
git bisect bad HEAD
git bisect good v2.3.0
git bisect run pnpm test:e2e:smoke
git bisect reset
```
### Rerere 의 conflict 의 reuse
```bash
git config --global rerere.enabled true
```
### Worktrees 의 parallel branches
```bash
git worktree add ../proj-hotfix hotfix/v2.3.1
git worktree remove ../proj-hotfix
```
### Sparse-checkout (monorepo)
```bash
git sparse-checkout init --cone
git sparse-checkout set apps/web packages/ui
```
### Signed commits (sigstore gitsign)
```bash
gitsign init
git -c commit.gpgsign=true commit -m "feat: thing"
gitsign verify HEAD --certificate-identity=me@org.com \
--certificate-oidc-issuer=https://accounts.google.com
```
## 매 결정 기준
| 상황 | Workflow |
|---|---|
| SaaS startup, daily deploy | trunk-based + feature flags |
| OSS library | GitHub Flow + protected main |
| regulated (releases) | release branches + CHANGELOG |
| monorepo of apps | trunk-based + Nx affected + sparse |
**기본값**: trunk-based, squash-merge, conventional commits, signed commits (gitsign), CODEOWNERS-protected main.
## 🔗 Graph
- 부모: [[DevOps]]
- 응용: [[Trunk-Based Development]] · [[Code Review]] · [[Monorepo]]
- Adjacent: [[CODEOWNERS]] · [[Conventional Commits]] · [[GitOps]]
## 🤖 LLM 활용
**언제**: commit message generation, PR description drafts, conflict resolution suggestions, blame summarization.
**언제 X**: rebasing 의 LLM-driven 의 unchecked — 매 history 의 corrupt 위험.
## ❌ 안티패턴
- **Long-lived feature branches** (>1wk): 매 merge hell.
- **Force-push to shared branches**: 매 teammates' work 의 destroy.
- **Big-bang commits**: 매 review impossible, bisect useless.
- **No CODEOWNERS**: 매 누구나 의 critical path 의 merge.
- **Secrets in history**: 매 even after rotation, 매 forever exposed.
## 🧪 검증 / 중복
- Verified (Pro Git book, GitHub flow docs, Trunk-Based Development site, Conventional Commits 1.0).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — git workflow + stacked PR + sigstore patterns |
@@ -0,0 +1,137 @@
---
id: wiki-2026-0508-speculative-execution
title: Speculative Execution
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-CCED4D, Branch Speculation, Out-of-order Execution]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [cpu, microarchitecture, security, performance, spectre]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: C / asm
framework: x86-64 / ARMv9
---
# Speculative Execution
## 매 한 줄
> **"매 CPU 의 매 branch 의 outcome 의 wait 의 X — 매 predicted path 의 의 ahead 의 execute, 매 wrong → rollback"**. 1990s Pentium Pro 매 first commercial impl → 2018 Spectre/Meltdown 매 the dark side 의 reveal → 2026 매 hardware mitigation (Intel CET, ARM BTI/MTE) + compiler hardening 매 standard.
## 매 핵심
### 매 mechanism
- **Branch predictor** 매 매 branch 의 taken/not-taken 의 history 의 학습 (TAGE, Perceptron).
- **Reorder buffer (ROB)** 매 매 speculative instruction 의 in-flight 의 hold.
- **Retire stage** 매 매 branch 의 resolved 의 후 의 commit (correct) or flush (mispredict).
- **Misprediction penalty**: 매 modern CPU 매 ~15-25 cycles.
### 매 dark side
- **Spectre v1 (Bounds Check Bypass)**: 매 attacker 의 branch predictor 의 train → 매 sensitive memory 의 cache 의 leak.
- **Spectre v2 (Branch Target Injection)**: 매 indirect branch 의 mispredict 의 force.
- **Meltdown**: 매 user 의 kernel memory 의 speculative read.
- **L1TF, MDS, Retbleed, GhostRace** (2018-2024): 매 variant 의 endless.
### 매 응용
1. CPU performance (1.5-3x IPC vs in-order).
2. Branch prediction research.
3. Compiler 매 PGO + autovectorization 의 enabler.
## 💻 패턴
### Pattern 1: 매 Spectre v1 매 PoC (educational)
```c
// 매 educational only
uint8_t array1[16] = {0};
uint8_t array2[256 * 512];
char* secret = "key";
unsigned int array1_size = 16;
void victim(size_t x) {
if (x < array1_size) { // <-- 매 trained branch
uint8_t v = array2[array1[x] * 512];
// 매 cache 의 leak via timing
}
}
// Attacker 매 array1_size 의 cache 의 evict → speculative path 매 OOB read
```
### Pattern 2: 매 LFENCE / 매 retpoline 의 mitigation
```c
// gcc -mindirect-branch=thunk-extern -mfunction-return=thunk-extern
static inline void speculation_barrier(void) {
__asm__ volatile ("lfence" ::: "memory");
}
bool safe_lookup(size_t i, size_t n, uint8_t* arr) {
if (i < n) {
speculation_barrier(); // 매 stops speculative path
return arr[i];
}
return 0;
}
```
### Pattern 3: 매 bench 의 branch misprediction
```c
// perf stat -e branches,branch-misses ./a.out
#include <stdio.h>
int main(int argc, char** argv) {
int sum = 0;
for (int i = 0; i < 1000000; i++) {
if (i % 2 == 0) sum += i; // 매 100% predictable
// if ((rand() & 1)) sum += i; // 매 50% miss → much slower
}
printf("%d\n", sum);
}
```
### Pattern 4: 매 V8 / JIT 의 speculative optimization
```js
// V8 매 hidden class 의 speculatively assume → 매 type 의 change → 매 deopt
function add(o) { return o.x + o.y; }
add({ x: 1, y: 2 }); // 매 monomorphic, JIT 의 specialize
add({ x: 1, y: 2, z: 3 }); // 매 hidden class 의 change → 매 deopt
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 user code 매 typical app | 매 default — speculation 매 win, 매 mitigation OS-level |
| 매 cryptography (constant-time req) | `LFENCE`, branchless code, 매 secret-dep 의 branch X |
| 매 multi-tenant cloud | site-isolation, hardware mitigation enable, microcode update |
| 매 perf-critical hot loop | Profile-guided opt + branchless when miss > 5% |
| 매 indirect call hot path | retpoline (Spectre v2) + IBRS off if isolated |
**기본값**: 매 OS + microcode 의 latest, 매 crypto code 매 constant-time, 매 hot-loop 매 PGO.
## 🔗 Graph
- 부모: [[CPU Bottleneck]] · [[Branch Prediction]]
- 변형: [[Out-of-order Execution]]
- 응용: [[V8 Engine]] · [[Spectre]]
## 🤖 LLM 활용
**언제**: 매 perf 분석 (branch-miss rate), 매 microbenchmark 의 design, 매 mitigation flag 의 trade-off 분석.
**언제 X**: 매 actual exploit 의 development — out of scope.
## ❌ 안티패턴
- **매 secret-dependent branch** 매 crypto code — 매 timing leak.
- **매 mitigation 의 disable** ("for performance") 매 multi-tenant host.
- **매 indirect call 의 hot loop** without retpoline 매 Spectre v2-vulnerable CPU.
- **매 unpredictable branch** 매 inner loop — 매 branchless (cmov, mask) 의 prefer.
## 🧪 검증 / 중복
- Verified (Hennessy & Patterson 6e Ch.3, Spectre paper Kocher 2018, Intel SDM Vol.3 Ch.2).
- 신뢰도 A.
- 중복 risk: [[Branch Prediction]] (related), [[Out-of-order Execution]] (parent mechanism).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — mechanism, Spectre family, mitigations 정리 |
@@ -0,0 +1,149 @@
---
id: wiki-2026-0508-statistics-data-analysis
title: "Statistics & Data Analysis"
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [stats, data analysis, applied statistics]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [statistics, data-analysis, ab-testing, ml, observability]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: python
framework: numpy-scipy-statsmodels-pymc
---
# Statistics & Data Analysis
## 매 한 줄
> **"매 data 의 lying 의 — 매 stats 의 catching"**. Statistics 의 uncertainty 의 quantify 의, 매 patterns 의 noise 의 separate 의 의 discipline. 2026 의 production 의 standard 의: Bayesian methods (PyMC, Stan), causal inference (DoWhy, EconML), CUPED 의 A/B test variance reduction.
## 매 핵심
### 매 핵심 dichotomy
- **Frequentist**: p-values, confidence intervals — 매 long-run frequency 의.
- **Bayesian**: posteriors, credible intervals — 매 belief update 의.
- **2026 trend**: Bayesian 의 production analytics 의 dominant (interpretable, sequential-safe).
### 매 must-know toolkit
- **Hypothesis tests**: t-test, Mann-Whitney, χ², Fisher exact.
- **Regression**: OLS, GLM (logistic, Poisson), mixed-effects.
- **Causal**: difference-in-differences, IV, RDD, synthetic control.
- **A/B**: CUPED, sequential testing (mSPRT), multi-armed bandits.
### 매 응용
1. Product A/B testing (CUPED + sequential).
2. SRE — anomaly detection on metrics.
3. SAST/SCA findings 의 risk scoring (Bayesian prior).
## 💻 패턴
### Welch t-test (A/B)
```python
import numpy as np
from scipy import stats
control = np.array([...])
treatment = np.array([...])
t, p = stats.ttest_ind(control, treatment, equal_var=False)
ci = stats.t.interval(0.95, len(control)+len(treatment)-2,
loc=treatment.mean()-control.mean(),
scale=stats.sem(np.concatenate([control, treatment])))
print(f"Δ={treatment.mean()-control.mean():.4f}, p={p:.4f}, 95%CI={ci}")
```
### CUPED variance reduction
```python
import numpy as np
def cuped_adjust(y_pre, y_post):
theta = np.cov(y_pre, y_post)[0,1] / np.var(y_pre)
return y_post - theta * (y_pre - y_pre.mean())
y_adj_c = cuped_adjust(pre_c, post_c)
y_adj_t = cuped_adjust(pre_t, post_t)
```
### Bayesian A/B (PyMC)
```python
import pymc as pm
with pm.Model() as m:
p_a = pm.Beta('p_a', 1, 1)
p_b = pm.Beta('p_b', 1, 1)
pm.Binomial('obs_a', n=n_a, p=p_a, observed=k_a)
pm.Binomial('obs_b', n=n_b, p=p_b, observed=k_b)
pm.Deterministic('lift', (p_b - p_a) / p_a)
idata = pm.sample(2000, tune=1000)
print(f"P(B>A) = {(idata.posterior['lift']>0).mean().item():.3f}")
```
### Sequential testing (mSPRT)
```python
import numpy as np
def msprt(x, y, sigma2_tau=0.01, alpha=0.05):
n = min(len(x), len(y))
delta = y[:n] - x[:n]
s2 = delta.var(ddof=1)
t = delta.mean() * np.sqrt(n)
lr = np.sqrt(s2/(s2+n*sigma2_tau)) * np.exp(
n*sigma2_tau*t**2 / (2*s2*(s2+n*sigma2_tau)))
return lr > 1/alpha
```
### Causal — difference-in-differences (statsmodels)
```python
import statsmodels.formula.api as smf
m = smf.ols('y ~ treated * post + C(unit) + C(time)', data=df).fit(
cov_type='cluster', cov_kwds={'groups': df['unit']})
print(m.params['treated:post'])
```
### Anomaly — robust z (MAD)
```python
import numpy as np
def mad_z(x):
med = np.median(x)
mad = np.median(np.abs(x - med))
return 0.6745 * (x - med) / (mad + 1e-9)
anomalies = np.abs(mad_z(latency_p99)) > 3.5
```
## 매 결정 기준
| 상황 | Method |
|---|---|
| 2-arm online experiment, fixed N | Welch t-test + CUPED |
| sequential / peeking 위험 | mSPRT or Bayesian |
| many arms, exploration value | Thompson sampling bandit |
| observational, treatment effect | DiD / IV / synthetic control |
| heavy-tailed (revenue) | Mann-Whitney + bootstrap CI |
**기본값**: Welch + CUPED for online A/B; Bayesian for small-N or peeking; bootstrap for non-Gaussian.
## 🔗 Graph
- 부모: [[Probability Theory]]
- 변형: [[Bayesian Statistics]] · [[Causal Inference]]
- 응용: [[Anomaly Detection]] · [[ML Evaluation]]
- Adjacent: [[PyMC]]
## 🤖 LLM 활용
**언제**: experiment design review, p-value 해석, choosing test for distribution shape, generating PyMC models from descriptions.
**언제 X**: trusting LLM-computed p-values 없이 의 verification — 매 arithmetic mistakes.
## ❌ 안티패턴
- **Peeking**: 매 fixed-N test 의 daily check 의 stop — 매 false positive rate 의 5% → 30%+.
- **HARKing**: 매 hypothesis after results known.
- **p<0.05 worship**: 매 effect size 무시.
- **Ignoring multiple testing**: 매 20 metrics 의 →약 1 의 false positive 의 expected.
- **CUPED 의 covariate 의 post-treatment 의**: 매 invalidates.
## 🧪 검증 / 중복
- Verified (Microsoft CUPED paper 2013, Optimizely Stats Engine, Gelman BDA3, Wasserman All of Stats).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — A/B + Bayesian + causal patterns |
@@ -0,0 +1,135 @@
---
id: wiki-2026-0508-stop-the-world
title: Stop the world
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-D2D9B2, STW, GC pause, Stop-the-world]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [gc, runtime, performance, latency, jvm, v8]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: Java / JS / Go
framework: HotSpot / V8 / Go runtime
---
# Stop the world
## 매 한 줄
> **"매 GC + 매 mutator 의 동시 실행 매 X — 매 모든 application thread 의 freeze, 매 GC 의 reclaim 의 후 의 resume"**. 1960s LISP MTS GC 매 origin → 1990s incremental → 2010s concurrent → 2026 매 ZGC / Shenandoah / Go 1.5+ 의 sub-millisecond STW. 매 STW 매 매 latency 의 archenemy.
## 매 핵심
### 매 왜 STW 의 필요
- **Heap traversal consistency**: 매 mark phase 매 reference graph 의 stable 의 require — 매 mutator 매 concurrent write 의 invariant break.
- **Root scanning**: 매 thread stack + 매 register 의 snapshot 의 atomic 매 collect.
- **Pointer update**: 매 compacting GC 매 매 reference 의 rewrite 의 atomic 매 require.
### 매 STW phase
- **Initial mark** (root scan) — 매 short.
- **Final mark / remark** — 매 mutator 의 missed reference 의 catch-up.
- **Reference processing** (weak/soft refs).
- **Cleanup / class unloading**.
### 매 modern GC 의 STW
- **HotSpot G1**: ~10-200ms (heap size 의 dependent).
- **HotSpot ZGC** (JDK 21+): < 1ms 매 always (concurrent compaction).
- **HotSpot Shenandoah**: < 10ms (Brooks pointers).
- **Go runtime**: < 0.5ms (concurrent + tri-color + write barrier).
- **V8 Orinoco**: < 1ms typical (parallel + concurrent + incremental).
### 매 응용
1. SLO design (p99 latency budget).
2. JVM tuning (heap + GC choice).
3. Real-time / financial / game 의 latency-critical app.
## 💻 패턴
### Pattern 1: 매 JVM 의 STW 의 measure (GC log)
```bash
# Java 21+
java -Xlog:gc*:file=gc.log:time,uptime,level,tags -Xmx4g -XX:+UseZGC App
# 매 log 의 분석
grep 'Pause' gc.log | awk '{print $NF}' | sort -n | tail
```
### Pattern 2: 매 V8 의 GC pause 의 trace (Node.js)
```bash
node --trace-gc --trace-gc-verbose app.js
# [12345:0x..] 1234 ms: Mark-sweep 64.5 (98.4) -> 32.1 (98.4) MB, 12.3 / 0.0 ms
```
### Pattern 3: 매 Go 의 GODEBUG 의 STW trace
```bash
GODEBUG=gctrace=1 ./myapp
# gc 1 @0.012s 0%: 0.012+0.36+0.005 ms clock, ...
# ^^^^^ ^^^^^^^^ ^^^^^
# STW init concurrent STW final
```
### Pattern 4: 매 STW-aware code (allocation 의 reduce)
```ts
// V8 매 large allocation 매 LO space → mark-sweep 의 trigger
// Hot path 매 매 allocation 의 minimize
const buf = Buffer.allocUnsafe(1024); // reuse
function process(data: Uint8Array): number {
let sum = 0;
for (let i = 0; i < data.length; i++) sum += data[i]; // 매 no allocation
return sum;
}
```
### Pattern 5: 매 production GC tuning (JVM)
```bash
# 매 SLO p99 < 50ms 매 latency-critical service
java -Xmx8g -Xms8g \
-XX:+UseZGC -XX:+ZGenerational \
-XX:+UnlockExperimentalVMOptions \
-XX:SoftMaxHeapSize=6g \
-Xlog:gc*:file=gc.log \
-jar app.jar
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Java batch / throughput | Parallel GC (longer STW OK) |
| Java latency-critical (p99 < 50ms) | ZGC (JDK 21+) or Shenandoah |
| Java legacy heap < 4G | G1 (default JDK 17+) |
| Go service | runtime default — tune `GOGC` |
| Node.js 매 long-lived process | `--max-old-space-size`, profile incremental marking |
| 매 Hard real-time (audio, robotics) | manual memory mgmt — 매 GC 의 X (Rust, C++) |
**기본값**: 매 latency app — 매 ZGC (Java) / 매 default Go runtime / 매 V8 incremental.
## 🔗 Graph
- 부모: [[V8 가비지 컬렉션(Garbage Collection)]] · [[가비지 컬렉터(Garbage Collector)]]
- 변형: [[Mark-Sweep-Compact(메이저 GC)]] · [[Major GC]] · [[Scavenge]]
- 응용: [[V8 Engine]] · [[자바 가상 머신(JVM)]] · [[동시성 및 점진적 마킹(Concurrent Incremental Marking)]]
- Adjacent: [[Memory Management]] · [[오리노코(Orinoco GC)]] · [[Cheneys Algorithm]]
## 🤖 LLM 활용
**언제**: 매 GC log 의 parse + summarize, 매 STW outlier 의 root-cause hypothesis, 매 GC flag 의 trade-off 분석.
**언제 X**: 매 production GC flag 의 LLM-only 의 decision — 매 load test 의 confirm 의 필요.
## ❌ 안티패턴
- **매 GC 의 manual trigger** (`System.gc()`, `--expose-gc`) 매 production — 매 STW 의 force, 매 worse latency.
- **매 huge heap** (-Xmx32g) + 매 G1 의 expectation 의 STW < 10ms — 매 G1 의 multi-GB heap 매 longer pause 의 inevitable, 매 ZGC 의 use.
- **매 short-lived object 의 fixed pool 의 cache** — 매 generational GC 의 already 의 efficient. 매 over-engineering.
- **매 GC log 의 production 의 disable** — 매 incident 의 post-mortem 의 impossible.
## 🧪 검증 / 중복
- Verified (HotSpot ZGC tuning guide JDK 21, Go runtime/mgc.go, V8 blog 'Orinoco' 2020-2024).
- 신뢰도 A.
- 중복 risk: [[Major GC]] (related phase), [[동시성 및 점진적 마킹(Concurrent Incremental Marking)]] (technique that 매 reduces STW).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — STW phases, modern GC pause budgets, tuning patterns 정리 |
@@ -0,0 +1,155 @@
---
id: wiki-2026-0508-storybook
title: Storybook
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Storybook.js, Component Workshop, UI Sandbox]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [frontend, components, testing, design-system, react]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: TypeScript
framework: Storybook 8 / React / Vue / Svelte
---
# Storybook
## 매 한 줄
> **"매 component 의 isolated workshop — 매 visual catalog + 매 interaction test + 매 a11y 의 single source"**. 2016 React Storybook (Arunoda) → 2026 Storybook 8 매 Vite-first + Test 매 first-class + 매 Chromatic 매 visual regression. 매 design-system 매 매 매 indispensable.
## 매 핵심
### 매 3 value
- **Isolation**: 매 component 의 매 props/state 의 explore 매 app context 의 X.
- **Documentation**: 매 stories 의 living spec — 매 Figma 의 ↔ 매 code 의 sync.
- **Testing**: 매 visual regression (Chromatic), 매 interaction (`play` fn), 매 a11y (axe).
### 매 file structure
- `Button.stories.tsx` 매 매 component 의 옆.
- `meta` (component, args, argTypes, parameters) + 매 export 별 매 story.
- CSF 3 (Component Story Format) 매 standard.
### 매 응용
1. Design-system component library.
2. Visual regression test (Chromatic / Loki).
3. Designer ↔ engineer collaboration.
## 💻 패턴
### Pattern 1: 매 CSF 3 매 story
```tsx
// Button.stories.tsx
import type { Meta, StoryObj } from '@storybook/react';
import { fn } from '@storybook/test';
import { Button } from './Button';
const meta = {
title: 'UI/Button',
component: Button,
args: { onClick: fn() },
argTypes: {
variant: { control: 'select', options: ['primary', 'secondary', 'ghost'] },
size: { control: 'radio', options: ['sm', 'md', 'lg'] },
},
parameters: { layout: 'centered' },
} satisfies Meta<typeof Button>;
export default meta;
type Story = StoryObj<typeof meta>;
export const Primary: Story = { args: { variant: 'primary', children: 'Save' } };
export const Disabled: Story = { args: { variant: 'primary', disabled: true, children: 'Save' } };
```
### Pattern 2: 매 interaction test (`play`)
```tsx
import { expect, userEvent, within } from '@storybook/test';
export const ClickIncrements: Story = {
args: { children: 'Click me' },
play: async ({ canvasElement, args }) => {
const canvas = within(canvasElement);
const btn = canvas.getByRole('button');
await userEvent.click(btn);
await userEvent.click(btn);
expect(args.onClick).toHaveBeenCalledTimes(2);
},
};
```
### Pattern 3: 매 a11y addon
```ts
// .storybook/preview.ts
import type { Preview } from '@storybook/react';
const preview: Preview = {
parameters: {
a11y: { config: { rules: [{ id: 'color-contrast', enabled: true }] } },
},
};
export default preview;
// 매 axe-core 매 매 story 매 자동 audit, panel 의 violation 의 surface
```
### Pattern 4: 매 Chromatic 매 visual regression CI
```yaml
# .github/workflows/chromatic.yml
- uses: chromaui/action@latest
with:
projectToken: ${{ secrets.CHROMATIC_PROJECT_TOKEN }}
onlyChanged: true
exitZeroOnChanges: false
```
### Pattern 5: 매 design token 의 import + 매 theme switch
```tsx
// .storybook/preview.tsx
import { withThemeByClassName } from '@storybook/addon-themes';
export const decorators = [
withThemeByClassName({
themes: { light: 'theme-light', dark: 'theme-dark' },
defaultTheme: 'light',
}),
];
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| Design-system / component lib | Storybook + Chromatic — default |
| App-only, no shared component | Storybook 매 optional — 매 cost > value 의 risk |
| Vue / Svelte / Angular | Storybook 의 multi-framework 의 native support |
| 매 mobile (RN) | Storybook React Native — viable but small ecosystem |
| Lightweight alt | Ladle (Vite-only, faster), Histoire (Vue-first) |
**기본값**: Storybook 8 + Vite + interaction test + Chromatic CI.
## 🔗 Graph
- 부모: [[Design System]]
- 응용: [[Component Library]] · [[Figma-to-Code-Workflow]]
- Adjacent: [[Test_Automation]] · [[CI_CD_Pipeline]] · [[Figma]]
## 🤖 LLM 활용
**언제**: 매 component 의 stories 의 boilerplate 의 generate, 매 interaction-test 의 scaffold, 매 design-spec ↔ args 의 sync.
**언제 X**: 매 visual judgment (snapshot review) — 매 designer 의 human review.
## ❌ 안티패턴
- **매 stories 의 component 의 모든 prop combo 의 explosion** — 매 visual diff 매 noise. 매 representative 매 5-10 의 keep.
- **매 fetch / global store 의 story 의 raw use** — 매 isolation broken. 매 mock + decorator.
- **매 interaction test 의 unit test 의 replace** — 매 unit (Vitest) + 매 interaction (Storybook) 의 complement.
- **Chromatic 의 baseline 의 매 PR 매 auto-accept** — 매 visual regression 의 silent miss.
## 🧪 검증 / 중복
- Verified (Storybook 8 docs 2025, Chromatic guide, CSF 3 RFC).
- 신뢰도 A.
- 중복 risk: 매 X (unique tool).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — CSF 3 patterns, play interaction, Chromatic, a11y 정리 |
@@ -0,0 +1,188 @@
---
id: wiki-2026-0508-test-automation
title: Test Automation
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [automated testing, test automation pyramid, CI testing]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [testing, automation, ci-cd, qa, devops]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: typescript
framework: vitest-playwright-msw-pact
---
# Test Automation
## 매 한 줄
> **"매 confidence 의 deploy 의 — 매 tests 의 paying 의"**. Test automation 의 unit / integration / e2e / contract / performance 의 의 CI 의 의 mechanically running 의 의 — 매 regression 의 catch, 매 deploy velocity 의 unlock. 2026 의 stack: Vitest (unit), Playwright (e2e), MSW (API mock), Pact (contract), k6 (load).
## 매 핵심
### 매 testing pyramid (modern)
- **Unit** (60-70%): 매 fast (<100ms each), 매 isolated, 매 logic 의.
- **Integration** (20-30%): 매 real DB / Redis 의 (testcontainers), 매 module boundaries.
- **Component** (10%): 매 React/Vue 의 isolated rendering.
- **E2E** (5-10%): 매 Playwright, 매 critical user journeys 의 only.
- **Contract**: producer/consumer 의 — 매 microservices.
### 매 매 modern paradigms
- **TDD** still relevant for libraries / domain logic.
- **Snapshot testing** judiciously — 매 churn explosion 위험.
- **Property-based** (fast-check, hypothesis) — 매 invariants.
- **Visual regression** (Chromatic, Percy, Playwright trace).
### 매 응용
1. PR-blocking unit + critical e2e.
2. Pre-merge contract tests (Pact broker).
3. Nightly load test + regression budget.
## 💻 패턴
### Vitest unit test
```typescript
import { describe, it, expect, vi } from 'vitest';
import { calcTax } from './tax';
describe('calcTax', () => {
it.each([
[100, 'CA', 8.25],
[100, 'OR', 0],
])('%i in %s = %f', (amt, state, expected) => {
expect(calcTax(amt, state)).toBe(expected);
});
it('rejects negative', () => {
expect(() => calcTax(-1, 'CA')).toThrow(/non-negative/);
});
});
```
### MSW — API mocking
```typescript
import { http, HttpResponse } from 'msw';
import { setupServer } from 'msw/node';
export const server = setupServer(
http.get('/api/users/:id', ({ params }) =>
HttpResponse.json({ id: params.id, name: 'Alice' })),
);
beforeAll(() => server.listen({ onUnhandledRequest: 'error' }));
afterEach(() => server.resetHandlers());
afterAll(() => server.close());
```
### Playwright e2e (critical path)
```typescript
import { test, expect } from '@playwright/test';
test('checkout flow', async ({ page }) => {
await page.goto('/');
await page.getByRole('button', { name: /add to cart/i }).first().click();
await page.getByRole('link', { name: /cart/i }).click();
await page.getByRole('button', { name: /checkout/i }).click();
await page.getByLabel(/email/i).fill('test@example.com');
await page.getByLabel(/card number/i).fill('4242424242424242');
await page.getByRole('button', { name: /pay/i }).click();
await expect(page.getByRole('heading', { name: /thank you/i })).toBeVisible();
});
```
### Testcontainers (real Postgres in CI)
```typescript
import { PostgreSqlContainer } from '@testcontainers/postgresql';
let container: any, db: any;
beforeAll(async () => {
container = await new PostgreSqlContainer('postgres:16').start();
db = drizzle(postgres(container.getConnectionUri()));
await migrate(db, { migrationsFolder: './drizzle' });
}, 60_000);
afterAll(async () => container.stop());
```
### Pact contract test (consumer)
```typescript
import { PactV3, MatchersV3 } from '@pact-foundation/pact';
const provider = new PactV3({ consumer: 'web', provider: 'api' });
provider.given('user 1 exists').uponReceiving('a request for user 1')
.withRequest({ method: 'GET', path: '/users/1' })
.willRespondWith({ status: 200, body: MatchersV3.like({ id: 1, name: 'Alice' }) });
await provider.executeTest(async (mock) => {
const r = await fetch(`${mock.url}/users/1`);
expect((await r.json()).name).toBe('Alice');
});
```
### Property-based (fast-check)
```typescript
import fc from 'fast-check';
test('reverse twice = identity', () => {
fc.assert(fc.property(fc.array(fc.integer()), (arr) => {
expect([...arr].reverse().reverse()).toEqual(arr);
}));
});
```
### Flaky-test quarantine (Playwright)
```typescript
test.describe.configure({ retries: 2 });
test('flaky-known @quarantine', async ({ page }) => { /* ... */ });
// CI: skip @quarantine on PR, run nightly only
```
### k6 load test
```javascript
import http from 'k6/http';
import { check } from 'k6';
export const options = {
stages: [{ duration: '2m', target: 100 }, { duration: '5m', target: 100 }],
thresholds: { http_req_duration: ['p(99)<500'] },
};
export default () => {
const r = http.get('https://staging.app/api/items');
check(r, { '200': (x) => x.status === 200 });
};
```
## 매 결정 기준
| 상황 | Layer |
|---|---|
| pure function / domain logic | unit (Vitest) |
| DB query / SQL correctness | integration (testcontainers) |
| critical revenue path | e2e (Playwright) |
| microservice API stability | contract (Pact) |
| invariant property | property-based (fast-check) |
**기본값**: 60/30/10 unit/integration/e2e split, MSW for external APIs, testcontainers for DB, Pact for service boundaries.
## 🔗 Graph
- 부모: [[Software Quality]]
- 변형: [[TDD]] · [[BDD]] · [[Property-based Testing]]
- 응용: [[Continuous Integration]] · [[Visual Regression]]
- Adjacent: [[Playwright]] · [[Pact]]
## 🤖 LLM 활용
**언제**: test scaffolding from impl, edge-case enumeration, flaky root-cause analysis from trace.zip, snapshot diff explanation.
**언제 X**: auto-generated tests 의 review 없이 의 merge — 매 tautological tests (mock returns x → assert x).
## ❌ 안티패턴
- **Ice-cream cone** (e2e-heavy, unit-light): 매 slow CI, 매 flaky.
- **Mocking what you don't own** (deep mocks of fetch): 매 mock drift.
- **Snapshot of everything**: 매 PR diff 의 noise.
- **Shared mutable state in tests**: 매 order-dependent flaky.
- **No quarantine**: 매 1 flaky 의 CI 의 distrust.
## 🧪 검증 / 중복
- Verified (Vitest docs, Playwright docs, MSW v2, Pact docs, k6 docs, Kent Beck TDD).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — pyramid + Vitest/Playwright/MSW/Pact patterns |
@@ -0,0 +1,148 @@
---
id: wiki-2026-0508-texture-atlas
title: Texture Atlas
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [P-Reinforce-AUTO-71CA1F, Sprite Sheet, Atlas, Texture Sheet]
duplicate_of: none
source_trust_level: A
confidence_score: 0.95
verification_status: applied
tags: [graphics, gpu, texture, draw-call, optimization]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: pending
tech_stack:
language: GLSL / TypeScript
framework: Three.js / WebGL2 / Unity / Unreal
---
# Texture Atlas
## 매 한 줄
> **"매 매 sprite/material 의 별도 texture 의 X — 매 single big texture 의 sub-rect 의 share, 매 draw-call 의 batch"**. 1990s arcade hardware 매 origin (sprite sheet) → 2010s mobile GL 매 standard → 2026 매 bindless texture (Vulkan 1.3, WebGPU)+ virtual texturing 의 era. 매 atlas 매 매 still 매 fundamental.
## 매 핵심
### 매 4 motivation
- **Draw-call reduction**: 매 same-material batch — 매 매 mobile GPU 매 critical.
- **Texture switch cost**: 매 GPU 의 texture-binding 매 stall — 매 atlas 매 single bind.
- **Cache locality**: 매 nearby UV 의 same memory page.
- **Compression efficiency**: 매 큰 texture 의 BC7/ASTC 의 better ratio.
### 매 trade-off
- **Bleeding**: 매 mipmap + 매 bilinear 매 인접 sub-rect 의 sample → 매 padding (2-4 px) 의 필요.
- **Wrap mode**: 매 atlas 매 `REPEAT` 의 incompatible — 매 `CLAMP_TO_EDGE` 만.
- **Update cost**: 매 sub-rect 의 update 매 entire texture 의 re-upload 의 risk (mitigated by `texSubImage`).
### 매 응용
1. 2D game sprite (Phaser, Pixi.js).
2. 3D static prop (Unreal lightmap atlas).
3. Font (signed-distance-field atlas).
4. UI icon system.
## 💻 패턴
### Pattern 1: 매 atlas 의 build (offline, TexturePacker / 매 자체)
```ts
// 매 자체 packer 매 simple max-rects
import { MaxRectsPacker } from 'maxrects-packer';
const packer = new MaxRectsPacker(2048, 2048, 2 /* padding */);
const inputs = [
{ width: 64, height: 64, name: 'icon-a' },
{ width: 128, height: 96, name: 'icon-b' },
// ...
];
packer.addArray(inputs);
const atlasJson = packer.bins[0].rects.map((r) => ({
name: r.data?.name, x: r.x, y: r.y, w: r.width, h: r.height,
}));
// 매 actual pixel composition 매 sharp / canvas 의 use
```
### Pattern 2: 매 Three.js 매 sub-UV
```ts
import * as THREE from 'three';
const atlas = new THREE.TextureLoader().load('/atlas.png');
atlas.wrapS = atlas.wrapT = THREE.ClampToEdgeWrapping;
// rect: { x: 64, y: 0, w: 64, h: 64 } in 1024x1024 atlas
const u0 = 64 / 1024, v0 = 0 / 1024;
const du = 64 / 1024, dv = 64 / 1024;
const geom = new THREE.PlaneGeometry(1, 1);
geom.setAttribute('uv', new THREE.Float32BufferAttribute([
u0, v0 + dv,
u0 + du, v0 + dv,
u0, v0,
u0 + du, v0,
], 2));
```
### Pattern 3: 매 dynamic atlas (`texSubImage2D`)
```ts
// runtime 매 새 sprite 의 add (e.g., user avatar)
gl.bindTexture(gl.TEXTURE_2D, atlasTex);
gl.texSubImage2D(gl.TEXTURE_2D, 0, x, y, w, h, gl.RGBA, gl.UNSIGNED_BYTE, pixels);
```
### Pattern 4: 매 SDF font atlas (msdfgen)
```glsl
// fragment shader 매 매 distance field 의 alpha 의 derive
in vec2 vUv;
uniform sampler2D uMsdf;
float median(vec3 v) { return max(min(v.r,v.g),min(max(v.r,v.g),v.b)); }
out vec4 fragColor;
void main() {
vec3 s = texture(uMsdf, vUv).rgb;
float d = median(s) - 0.5;
float alpha = smoothstep(-0.05, 0.05, d);
fragColor = vec4(1.0, 1.0, 1.0, alpha);
}
```
### Pattern 5: 매 array texture 매 atlas alternative (WebGL2)
```ts
const tex = gl.createTexture();
gl.bindTexture(gl.TEXTURE_2D_ARRAY, tex);
gl.texImage3D(gl.TEXTURE_2D_ARRAY, 0, gl.RGBA8, 256, 256, layers, 0, gl.RGBA, gl.UNSIGNED_BYTE, null);
// 매 layer 별 upload — 매 bleeding X, wrap OK, but 매 same size 의 require
```
## 매 결정 기준
| 상황 | Approach |
|---|---|
| 매 매 same size 의 sprite | Array texture (no bleed) |
| 매 매 mixed size, mobile | Atlas + 2-4 px padding + CLAMP |
| 매 매 procedural / runtime sprite add | Dynamic atlas + `texSubImage` |
| 매 매 large unique texture (terrain) | Virtual / sparse texture |
| 매 font | SDF / MSDF atlas |
| 매 modern desktop / WebGPU | Bindless / array — atlas 의 less critical |
**기본값**: 2048x2048 atlas + 2px padding + CLAMP_TO_EDGE + offline packer (TexturePacker / sharp).
## 🔗 Graph
- 응용: [[Draw Call]] · [[BatchedMesh 및 InstancedMesh 성능 벤치마크]]
- Adjacent: [[Frustum Culling]] · [[Geometry Merging]] · [[Data Array Textures]]
## 🤖 LLM 활용
**언제**: 매 atlas layout 의 design (rect packing strategy), 매 padding/wrap bug 의 diagnose, 매 SDF shader 의 derivation.
**언제 X**: 매 actual pixel composition — 매 CLI tool (TexturePacker, sharp) 의 더 reliable.
## ❌ 안티패턴
- **매 padding 의 X** + 매 mipmap → 매 visible bleeding seam.
- **매 atlas 의 `REPEAT` 의 expectation** — 매 sub-rect 매 wrap mode 의 incompatible.
- **매 atlas 의 over-large** (> 4096 매 mobile) — 매 GPU memory + 매 fillrate cost.
- **매 매 frame 매 atlas 의 rebuild** — 매 GPU upload cost 매 huge. 매 dirty-rect partial update.
- **매 매 sprite 의 별도 atlas** — 매 batching 의 defeat 의 purpose.
## 🧪 검증 / 중복
- Verified (Real-Time Rendering 4e Ch.6, Three.js docs r170, msdfgen Chlumský 2017).
- 신뢰도 A.
- 중복 risk: [[Sprite Sheet]] (alias).
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — atlas motivation, packer/Three.js/SDF/array texture patterns 정리 |
@@ -0,0 +1,34 @@
---
id: wiki-2026-0508-toss-front-sdk의-facade-패턴-적용-사례
title: Toss Front SDK의 Facade 패턴 적용 사례
category: 10_Wiki/Topics
status: duplicate
canonical_id: facade-pattern
duplicate_of: "[[Facade Pattern]]"
aliases: []
source_trust_level: A
confidence_score: 0.9
verification_status: redirected
tags: [duplicate, design-pattern, facade, sdk]
last_reinforced: 2026-05-10
github_commit: pending
---
# Toss Front SDK의 Facade 패턴 적용 사례
> **이 문서는 [[Facade Pattern]] 의 중복본입니다.** Canonical 문서로 redirect.
## 핵심 요약 (Toss-specific)
- Toss Payments SDK 매 internal: HTTP client + auth + retry + iframe + risk-engine 의 합.
- 매 외부 노출 의 `loadTossPayments(clientKey).requestPayment(...)` 의 single facade.
- 매 caller 의 internal coupling 0 — 매 SDK upgrade 의 backward-compat 유지.
## 🔗 Graph
- 부모: [[Facade Pattern]] (canonical)
- Adjacent: [[SDK Design]]
## 🕓 변경 이력
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | 중복 처리 — Facade Pattern canonical 문서로 redirect |

Some files were not shown because too many files have changed in this diff Show More