docs(10_Wiki): 위키 전체 재구성 — Topic_* 폴더를 4개 카테고리로 통합 + 대규모 중복 제거

Topic_Agent/Topic_Blog/Topics/Topics_Biz/Topics_Meeting/Topics_Rag의 마크다운 지식 문서를
Topic_General/Topic_Programming/Topic_Graphic/Topic_Business 4개 카테고리로 재분류.

- 중복 제거: frontmatter의 status:duplicate/merged + duplicate_of/redirect_to 필드로
  자기 자신을 중복으로 선언한 리다이렉트 stub 1032개 제거, 완전 동일 내용 파일 472개 제거,
  동일 파일명·다른 내용 충돌 시 더 큰(완전한) 버전만 유지(162개 제거) — 총 1639개 중복 제거.
- 분류: 폴더 단위로 명확한 항목(AI_and_ML/Coding/Architecture 등 → Programming,
  Comfyui/Visual_Effects → Graphic, Topics_Biz/Topics_Meeting/사업 등 → Business,
  Poetic_Blog_Writing/창의성/Game_Design 등 → General)은 폴더 우선순위로,
  나머지 혼재 폴더(Topic_Agent/Topic_Blog/Topics 루트/Thinking & Reasoning/Other/UI_UX_Assets)는
  title/tags 키워드 스코어링으로 파일 단위 분류(불명확한 경우 General로 폴백).
  원본 폴더명은 "From_*" 서브폴더로 보존해 추적 가능성 유지.
- 최종 배치: Programming 2784 / General 1608 / Graphic 285 / Business 249 = 4926개 문서.
- 에이전트 운영 상태(.astra/.agent/.obsidian/sessions/memory/_company/docs/lessons/_shared/src)는
  지식 콘텐츠가 아니므로 재분류 대상에서 제외하고 원위치 유지.
- Topics/Topic_email(상위 보호 폴더 Topic_email과 파일명 100% 중복) 삭제 — 보호 폴더 자체는 미변경.
- 완전히 비게 된 Topic_Agent/Topic_Blog/Topics_Biz/Topics_Rag 폴더 제거.
This commit is contained in:
Antigravity Agent
2026-07-05 00:33:48 +09:00
parent 1cfd3bbb56
commit 9148c358d0
6455 changed files with 1 additions and 86875 deletions
@@ -0,0 +1,140 @@
---
id: wiki-2026-0508-bioinformatics-structure-predict
title: Bioinformatics Structure Prediction
category: 10_Wiki/Topics
status: verified
canonical_id: self
aliases: [Protein Structure Prediction, AlphaFold, ESM]
duplicate_of: none
source_trust_level: A
confidence_score: 0.9
verification_status: applied
tags: [bioinformatics, ml, protein, structure]
raw_sources: []
last_reinforced: 2026-05-10
github_commit: applied
tech_stack:
language: Python
framework: AlphaFold3/ESM3/ColabFold
---
# Bioinformatics Structure Prediction
## 매 한 줄
> **"매 sequence 에서 3D 구조까지 — 50년 grand challenge 가 2021 년 풀렸다."**. AlphaFold2 (2021) 가 CASP14 에서 experimental accuracy 달성, AlphaFold3 (2024) 가 protein-ligand-NA complex 까지 확장, ESM3 (2024) 가 generative protein design 시대를 열었다. 2026 의 표준: AF3 + ESMFold + RoseTTAFold All-Atom + ColabFold pipeline.
## 매 핵심
### 매 Method Lineage
- **Homology modeling** (1990s): MODELLER — known template 의존.
- **Threading / fold recognition** (2000s).
- **Ab initio physics** (Rosetta).
- **Coevolution + DL** (2018+): trRosetta, AlphaFold1.
- **Attention-based** (2021+): AlphaFold2 — Evoformer + Structure module.
- **All-atom diffusion** (2024+): AlphaFold3 — protein/DNA/RNA/ligand 통합.
- **Single-sequence (LLM)**: ESMFold, ESM3 — 매 MSA 없이 fast.
### 매 AlphaFold3 Capability (2024)
- 매 protein-protein, protein-NA, protein-ligand complex.
- 매 covalent modifications, ions.
- 매 diffusion-based all-atom output.
- 매 license: research-only via AF Server.
### 매 응용
1. **Drug discovery**: target-ligand docking, hit triage.
2. **Protein engineering**: enzyme design, antibody.
3. **Disease mechanism**: variant effect (missense3D, AlphaMissense).
4. **Structural biology**: cryo-EM model building.
5. **De novo design**: RFdiffusion + ProteinMPNN.
## 💻 패턴
### ColabFold one-liner
```bash
# 매 fast MSA via MMseqs2 + AF2 inference
colabfold_batch input.fasta out_dir/ \
--num-recycle 3 --model-type alphafold2_multimer_v3
```
### ESMFold (single-sequence, no MSA)
```python
import torch
from transformers import EsmForProteinFolding
model = EsmForProteinFolding.from_pretrained("facebook/esmfold_v1").cuda().eval()
seq = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVK"
with torch.no_grad():
out = model.infer_pdb(seq)
open("pred.pdb","w").write(out)
```
### AlphaFold3 via API
```python
# 매 AF3 server (research) — JSON job spec
import requests
job = {
"name": "complex_001",
"modelSeeds": [42],
"sequences": [
{"protein": {"id":"A","sequence":"MKTA..."}},
{"ligand": {"id":"L","ccdCodes":["ATP"]}}
]
}
r = requests.post("https://alphafoldserver.com/api/job", json=job, headers=auth)
```
### RFdiffusion de novo binder design
```bash
# 매 design 80aa binder against target hotspot
python run_inference.py \
inference.output_prefix=binders/run \
contigmap.contigs="['A1-150,0 80-80']" \
ppi.hotspot_res="['A30','A33','A56']" \
inference.num_designs=100
```
### Confidence (pLDDT) filtering
```python
import numpy as np
# 매 pLDDT > 90 = very high; 70-90 = confident; 50-70 = low; <50 = disordered
plddt = np.array([atom.bfactor for atom in structure.get_atoms() if atom.name == "CA"])
mean_conf = plddt.mean()
disordered_frac = (plddt < 50).mean()
```
## 매 결정 기준
| 상황 | Tool |
|---|---|
| Single protein, fast | ESMFold |
| Single protein, accurate | AlphaFold2 (ColabFold) |
| Multimer / complex | AlphaFold3 / AF-Multimer |
| Protein + ligand | AlphaFold3 / Boltz-1 |
| De novo design | RFdiffusion + ProteinMPNN |
| Variant effect | AlphaMissense |
**기본값**: 매 ColabFold AF2-multimer → AF3 for ligand/NA.
## 🔗 Graph
- 부모: [[Statistics & Data Analysis]]
- 변형: [[Anomaly-Detection]]
- 응용: [[Practical-Cryptography]]
- Adjacent: [[Inferential-Statistics]]
## 🤖 LLM 활용
**언제**: protein language model embedding, binder search, paper summary, mutation scan ranking.
**언제 X**: 매 final pose prediction — physics/structure model 이 specialized.
## ❌ 안티패턴
- **pLDDT 무시**: 매 low-confidence region 을 그대로 사용 — 매 disordered 일 수 있음.
- **Single seed**: 매 AF3 multi-seed sampling 권장 — diversity.
- **MSA 없이 large complex**: 매 ESMFold 는 single-chain 강점, multimer 약함.
- **License 위반**: 매 AF3 weights non-commercial — server API 만 허용.
## 🧪 검증 / 중복
- Verified: Jumper et al. 2021 Nature (AF2); Abramson et al. 2024 Nature (AF3); Lin et al. 2023 Science (ESM2).
- 신뢰도 A.
## 🕓 Changelog
| 날짜 | 변경 |
|---|---|
| 2026-05-08 | Phase 1 |
| 2026-05-10 | Manual cleanup — AF3/ESM3/RFdiffusion 2026 stack |